Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

Application Data (Detection limit for recombinant GST tagged TFAP4 is approximately 0.1ng/ml as a capture antibody.)

Mouse TFAP4 Monoclonal Antibody | anti-TFAP4 antibody

TFAP4 (Transcription Factor AP-4 (Activating Enhancer Binding Protein 4), AP-4, bHLHc41) (AP)

Gene Names
TFAP4; AP-4; bHLHc41
Applications
Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
TFAP4; Monoclonal Antibody; TFAP4 (Transcription Factor AP-4 (Activating Enhancer Binding Protein 4); AP-4; bHLHc41) (AP); Transcription Factor AP-4 (Activating Enhancer Binding Protein 4); bHLHc41; anti-TFAP4 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6B1
Specificity
Recognizes TFAP4.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-TFAP4 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
TFAP4 (NP_003214, 93aa-192aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AEYIFSLEQEKTRLLQQNTQLKRFIQELSGSSPKRRRAEDKDEGIGSPDIWEDEKAEDLRREMIELRQQLDKERSVRMMLEEQVRSLEAHMYPEKLKVIA
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Application Data

(Detection limit for recombinant GST tagged TFAP4 is approximately 0.1ng/ml as a capture antibody.)

Application Data (Detection limit for recombinant GST tagged TFAP4 is approximately 0.1ng/ml as a capture antibody.)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to TFAP4 on formalin-fixed paraffin-embedded human uterine cervix. [antibody concentration 1 ug/ml])

IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to TFAP4 on formalin-fixed paraffin-embedded human uterine cervix. [antibody concentration 1 ug/ml])

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to TFAP4 on formalin-fixed paraffin-embedded human uterine cervix. [antibody concentration 1 ug/ml])

IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to TFAP4 on formalin-fixed paraffin-embedded human uterine cervix. [antibody concentration 1 ug/ml])

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to TFAP4 on HeLa cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to TFAP4 on HeLa cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to TFAP4 on HeLa cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to TFAP4 on HeLa cell. [antibody concentration 10 ug/ml])

WB (Western Blot)

(TFAP4 monoclonal antibody (M01), clone 6B1 Western Blot analysis of TFAP4 expression in Hela S3 NE.)

WB (Western Blot) (TFAP4 monoclonal antibody (M01), clone 6B1 Western Blot analysis of TFAP4 expression in Hela S3 NE.)
Related Product Information for anti-TFAP4 antibody
Transcription factors of the basic helix-loop-helix-zipper (bHLH-ZIP) family contain a basic domain, which is used for DNA binding, and HLH and ZIP domains, which are used for oligomerization. Transcription factor AP4 activates both viral and cellular genes by binding to the symmetrical DNA sequence CAGCTG (Mermod et al., 1988 [PubMed 2833704]; Hu et al., 1990 [PubMed 2123466]). [supplied by OMIM]
Product Categories/Family for anti-TFAP4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
transcription factor AP-4
NCBI Official Synonym Full Names
transcription factor AP-4
NCBI Official Symbol
TFAP4
NCBI Official Synonym Symbols
AP-4; bHLHc41
NCBI Protein Information
transcription factor AP-4
UniProt Protein Name
Transcription factor AP-4
UniProt Gene Name
TFAP4
UniProt Synonym Gene Names
BHLHC41; bHLHc41
UniProt Entry Name
TFAP4_HUMAN

Similar Products

Product Notes

The TFAP4 tfap4 (Catalog #AAA25935) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TFAP4 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TFAP4 tfap4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TFAP4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.