<
ChIP (Chromatin Immunoprecipitation)
(Chromatin immunoprecipitation analysis of extracts of HeLa cells, using TriMethyl-Histone H3-K36 antibody (AAA28630) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.)
Rabbit anti-Human TriMethyl-Histone H3-K36 Monoclonal Antibody | anti-H3-K36 antibody
TriMethyl-Histone H3-K36 Rabbit mAb
Reactivity
Human
Applications
Western Blot, Dot Blot, Immunohistochemistry, Immunoprecipitation, ELISA, Chromatin Immunoprecipitation, Immunoprecipitation, Chromatin Immunoprecipitation, Immunoprecipitation
Purity
Affinity purification
Synonyms
TriMethyl-Histone H3-K36, Antibody; TriMethyl-Histone H3-K36 Rabbit mAb; H3.4; H3/g; H3FT; H3t; HIST3H3; Histone H3; HIST1H3A; TriMethyl-Histone H3-K36; anti-H3-K36 antibody
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY
Applicable Applications for anti-H3-K36 antibody
Western Blot (WB), Dot Blot (DB), Immunohistochemistry-Paraffin (IHC-P), Immunoprecipitation (IP), ELISA (EIA), Chromatin Immunoprecipitation (ChIP), Chromatin Immunoprecipitation (ChIP)-seq
Application Notes
WB: 1:500-1:1000
DB: 1:500-1:1000
IHC-P: 1:100-1:500
IP: 0.5ug-4ug antibody for 200ug-400ug extracts of whole cells
ELISA: Recommended starting concentration is 1ug/mL.
Please optimize the concentration based on your specific assay requirements.
ChIP: 5ug antibody for 5ug-10ug of Chromatin
ChIP-seq: 1:50-1:100
DB: 1:500-1:1000
IHC-P: 1:100-1:500
IP: 0.5ug-4ug antibody for 200ug-400ug extracts of whole cells
ELISA: Recommended starting concentration is 1ug/mL.
Please optimize the concentration based on your specific assay requirements.
ChIP: 5ug antibody for 5ug-10ug of Chromatin
ChIP-seq: 1:50-1:100
Cross Reactivity
Human, Mouse, Rat, Other (Wide Range Predicted)
Immunogen
A synthetic trimethylated peptide around K36 of human Histone H3 (NP_003520.1).
Modification
TriMethyl K36
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
ChIP (Chromatin Immunoprecipitation)
(Chromatin immunoprecipitation analysis of extracts of HeLa cells, using TriMethyl-Histone H3-K36 antibody (AAA28630) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.)
ChIP (Chromatin Immunoprecipitation)
(Chromatin immunoprecipitation analysis of extracts of HeLa cells, using TriMethyl-Histone H3-K36 antibody (AAA28630) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.)
IP (Immunoprecipitation)
(Immunoprecipitation analysis of 600 ug extracts of 293F cells using 5 ug TriMethyl-Histone H3-K36 antibody (AAA28630). Western blot was performed from the immunoprecipitate using TriMethyl-Histone H3-K36 antibody (AAA28630) at a dilution of 1:1000.)
IP (Immunoprecipitation)
(Immunoprecipitation analysis of 600 ug extracts of 293F cells using 5 ug TriMethyl-Histone H3-K36 antibody (AAA28630). Western blot was performed from the immunoprecipitate using TriMethyl-Histone H3-K36 antibody (AAA28630) at a dilution of 1:1000.)
IHC (Immunohistochemistry)
(Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using TriMethyl-Histone H3-K36 Rabbit mAb (AAA28630) at a dilution of 1:500 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)
IHC (Immunohistochemistry)
(Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using TriMethyl-Histone H3-K36 Rabbit mAb (AAA28630) at a dilution of 1:500 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)
IHC (Immunohistochemistry)
(Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using TriMethyl-Histone H3-K36 Rabbit mAb (AAA28630) at a dilution of 1:500 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)
IHC (Immunohistochemistry)
(Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using TriMethyl-Histone H3-K36 Rabbit mAb (AAA28630) at a dilution of 1:500 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)
DB (Dot Blot)
(Dot-blot analysis of all sorts of peptides using TriMethyl-Histone H3-K36 antibody (AAA28630) at 1:1000 dilution.)
DB (Dot Blot)
(Dot-blot analysis of all sorts of peptides using TriMethyl-Histone H3-K36 antibody (AAA28630) at 1:1000 dilution.)
WB (Western Blot)
(Western blot analysis of various lysates using TriMethyl-Histone H3-K36 Rabbit mAb (AAA28630) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)
WB (Western Blot)
(Western blot analysis of various lysates using TriMethyl-Histone H3-K36 Rabbit mAb (AAA28630) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)
ChIP (Chromatin Immunoprecipitation)
(Chromatin immunoprecipitations were performed with cross-linked chromatin from HeLa cells and H3K36me3 Rabbit mAb (AAA28630). The ChIP sequencing results indicate the enrichment pattern of H3K36me3 in selected genomic region and representative gene loci (GAPDH), as shown in figure.)
ChIP (Chromatin Immunoprecipitation)
(Chromatin immunoprecipitations were performed with cross-linked chromatin from HeLa cells and H3K36me3 Rabbit mAb (AAA28630). The ChIP sequencing results indicate the enrichment pattern of H3K36me3 in selected genomic region and representative gene loci (GAPDH), as shown in figure.)
Related Product Information for anti-H3-K36 antibody
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H3 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is located separately from the other H3 genes that are in the histone gene cluster on chromosome 6p22-p21.3.
Product Categories/Family for anti-H3-K36 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated MW: 15kDa
UniProt Protein Name
Histone H3.1t
UniProt Gene Name
HIST3H3
UniProt Synonym Gene Names
H3FT; H3/t; H3t
UniProt Entry Name
H31T_HUMAN
Similar Products
Product Notes
The H3-K36 hist3h3 (Catalog #AAA28630) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TriMethyl-Histone H3-K36 Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TriMethyl-Histone H3-K36 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Dot Blot (DB), Immunohistochemistry-Paraffin (IHC-P), Immunoprecipitation (IP), ELISA (EIA), Chromatin Immunoprecipitation (ChIP), Chromatin Immunoprecipitation (ChIP)-seq. WB: 1:500-1:1000 DB: 1:500-1:1000 IHC-P: 1:100-1:500 IP: 0.5ug-4ug antibody for 200ug-400ug extracts of whole cells ELISA: Recommended starting concentration is 1ug/mL. Please optimize the concentration based on your specific assay requirements. ChIP: 5ug antibody for 5ug-10ug of Chromatin ChIP-seq: 1:50-1:100. Researchers should empirically determine the suitability of the H3-K36 hist3h3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MARTKQTARK STGGKAPRKQ LATKAARKSA PATGGVKKPH RYRPGTVALR EIRRYQKSTE LLIRKLPFQR LVREIAQDFK TDLRFQSSAV MALQEACEAY. It is sometimes possible for the material contained within the vial of "TriMethyl-Histone H3-K36, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.