Mouse anti-Human TYK2 Monoclonal Antibody | anti-TYK2 antibody

TYK2 (Non-receptor Tyrosine-protein Kinase TYK2, JTK1) (PE)

Cat. Num. AAA25877

• Gene Names: TYK2; JTK1; IMD35
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: TYK2, Antibody; TYK2 (Non-receptor Tyrosine-protein Kinase TYK2, JTK1) (PE); EC=2.7.10.2; anti-TYK2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 6G12
• Specificity: Recognizes human TYK2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.4. No preservative added. Labeled with R-Phycoerythrin (PE).
• Concentration: 0.45 mg/mL (varies by lot)

• Applicable Applications for anti-TYK2 antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.; Immunohistochemistry: Formalin fixed, paraffin embedded tissues Optimal dilutions to be determined by the researcher.; IF: 10ug/ml
• Immunogen: Partial recombinant corresponding to aa276-375 from human TYK2 (AAH14243) with GST tag. MW of the GST tag alone is 26kD.
• Conjugate: PE
• Amino Acid Sequence: PVCHLRLLAQAEGEPCYIRDSGVAPTDPGPESAAGPPTHEVLVTGTGGIQWWPVEEEVNKEEGSSGSSGRNPQASLFGKKAKAHKAFGQPADRPREPLWA
• Preparation and Storage: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

IP (Immunoprecipitation)

(Immunoprecipitation of TYK2 transfected lysate using TYK2 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with TYK2 rabbit polyclonal antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to TYK2 on HeLa cells using [antibody concentration 10ug/ml])

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to TYK2 on formalin-fixed paraffin-embedded human colon using [antibody concentration 3ug/ml])

WB (Western Blot)

(Western Blot analysis of TYK2 expression in transfected 293T cell line using 1: TYK2 transfected lysate (133.7kD).Lane 2: Non-transfected lysate.)

WB (Western Blot)

(TYK2 monoclonal antibody, Western Blot analysis of TYK2 expression in HeLa cells using .)

ELISA

(Detection limit for recombinant GST tagged TYK2 is 1ng/mL using AAA25877 as a capture antibody.)

Product Categories/Family for anti-TYK2 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 33878411
• NCBI GeneID: 7297
• NCBI Official Full Name: Homo sapiens tyrosine kinase 2, mRNA
• NCBI Official Synonym Full Names: tyrosine kinase 2
• NCBI Official Symbol: TYK2
• NCBI Official Synonym Symbols: JTK1; IMD35
• NCBI Protein Information: non-receptor tyrosine-protein kinase TYK2