SDS-PAGE
Nucleoprotein Recombinant Protein | N recombinant protein
Recombinant Newcastle disease virus (strain Chicken/United States/B1/48) (NDV) Nucleoprotein
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Nucleoprotein; N/A; Recombinant Newcastle disease virus (strain Chicken/United States/B1/48) (NDV) Nucleoprotein; Nucleocapsid protein; NP; Protein N; N recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-489aa; Full Length
Sequence
MSSVFDEYEQLLAAQTRPNGAHGGGEKGSTLKVDVPVFTLNSDDPEDRWSFVVFCLRIAVSEDANKPLRQGALISLLCSHSQVMRNHVALAGKQNEATLAVLEIDGFANGTPQFNNRSGVSEERAQRFAMIAGSLPRACSNGTPFVTAGAEDDAPEDITDTLERILSIQAQVWVTVAKAMTAYETADESETRRINKYMQQGRVQKKYILYPVCRSTIQLTIRQSLAVRIFLVSELKRGRNTAGGTSTYYNLVGDVDSYIRNTGLTAFFLTLKYGINTKTSALALSSLSGDIQKMKQLMRLYRMKGDNAPYMTLLGDSDQMSFAPAEYAQLYSFAMGMASVLDKGTGKYQFAKDFMSTSFWRLGVEYAQAQGSSINEDMAAELKLTPAARRGLAAAAQRVSEVTSSIDMPTQQVGVLTGLSEGGSQALQGGSNRSQGQPEAGDGETQFLDLMRAVANSMREAPNSAQGTPQSGPPPTPGPSQDNDTDWGY
Species
Newcastle disease virus (strain Chicken/United States/B1/48) (NDV)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for N recombinant protein
Encapsidates the genome, protecting it from nucleases. The nucleocapsid (NC) has a helical structure. The encapsidated genomic RNA is termed the NC and serves as template for transcription and replication. During replication, encapsidation by N is coupled to RNA synthesis and all replicative products are resistant to nucleases
Product Categories/Family for N recombinant protein
References
"Complete sequence for the B1 strain of Newcastle disease virus." Sellers H.S., Seal B.S. Submitted (SEP-2000)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57 kDa
NCBI Official Full Name
nucleocapsid protein
NCBI Official Symbol
NP
NCBI Protein Information
nucleocapsid protein
UniProt Protein Name
Nucleoprotein
UniProt Gene Name
N
UniProt Synonym Gene Names
NP; NP; Protein N
UniProt Entry Name
NCAP_NDVB1
Similar Products
Product Notes
The N n (Catalog #AAA117625) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-489aa; Full Length. The amino acid sequence is listed below: MSSVFDEYEQ LLAAQTRPNG AHGGGEKGST LKVDVPVFTL NSDDPEDRWS FVVFCLRIAV SEDANKPLRQ GALISLLCSH SQVMRNHVAL AGKQNEATLA VLEIDGFANG TPQFNNRSGV SEERAQRFAM IAGSLPRACS NGTPFVTAGA EDDAPEDITD TLERILSIQA QVWVTVAKAM TAYETADESE TRRINKYMQQ GRVQKKYILY PVCRSTIQLT IRQSLAVRIF LVSELKRGRN TAGGTSTYYN LVGDVDSYIR NTGLTAFFLT LKYGINTKTS ALALSSLSGD IQKMKQLMRL YRMKGDNAPY MTLLGDSDQM SFAPAEYAQL YSFAMGMASV LDKGTGKYQF AKDFMSTSFW RLGVEYAQAQ GSSINEDMAA ELKLTPAARR GLAAAAQRVS EVTSSIDMPT QQVGVLTGLS EGGSQALQGG SNRSQGQPEA GDGETQFLDL MRAVANSMRE APNSAQGTPQ SGPPPTPGPS QDNDTDWGY. It is sometimes possible for the material contained within the vial of "Nucleoprotein, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.