SDS-PAGE
Calcium-dependent phospholipase A2 (PLA2G5) Recombinant Protein | PLA2G5 recombinant protein
Recombinant Human Calcium-dependent phospholipase A2 (PLA2G5)
Gene Names
PLA2G5; FRFB; GV-PLA2; PLA2-10; hVPLA(2)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Calcium-dependent phospholipase A2 (PLA2G5); N/A; Recombinant Human Calcium-dependent phospholipase A2 (PLA2G5); PLA2G5 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
21-138aa; Full Length of Mature Protein
Sequence
GLLDLKSMIEKVTGKNALTNYGFYGCYCGWGGRGTPKDGTDWCCWAHDHCYGRLEEKGCNIRTQSYKYRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILCS
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-PAGE
SDS-PAGE
Related Product Information for PLA2G5 recombinant protein
This gene is a member of the secretory phospholipase A2 family. It is located in a tightly-linked cluster of secretory phospholipase A2 genes on chromosome 1. The encoded enzyme catalyzes the hydrolysis of membrane phospholipids to generate lysophospholipids and free fatty acids including arachidonic acid. It preferentially hydrolyzes linoleoyl-containing phosphatidylcholine substrates. Secretion of this enzyme is thought to induce inflammatory responses in neighboring cells. Alternatively spliced transcript variants have been found, but their full-length nature has not been determined.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
15.6 kDa
NCBI Official Full Name
calcium-dependent phospholipase A2
NCBI Official Synonym Full Names
phospholipase A2 group V
NCBI Official Symbol
PLA2G5
NCBI Official Synonym Symbols
FRFB; GV-PLA2; PLA2-10; hVPLA(2)
NCBI Protein Information
calcium-dependent phospholipase A2
UniProt Protein Name
Calcium-dependent phospholipase A2
UniProt Gene Name
PLA2G5
Similar Products
Product Notes
The PLA2G5 pla2g5 (Catalog #AAA113392) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 21-138aa; Full Length of Mature Protein. The amino acid sequence is listed below: GLLDLKSMIE KVTGKNALTN YGFYGCYCGW GGRGTPKDGT DWCCWAHDHC YGRLEEKGCN IRTQSYKYRF AWGVVTCEPG PFCHVNLCAC DRKLVYCLKR NLRSYNPQYQ YFPNILCS. It is sometimes possible for the material contained within the vial of "Calcium-dependent phospholipase A2 (PLA2G5), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.