Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online
product-image-AAA23506_WB6.jpg WB (Western Blot) (WB Suggested Anti-COX4I1 Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysateCOX4I1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

Rabbit COX4I1 Polyclonal Antibody | anti-COX4I1 antibody

COX4I1 antibody - N-terminal region

Gene Names
COX4I1; COX4; COXIV; COX4-1; COXIV-1; COX IV-1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
COX4I1, Antibody; COX4I1 antibody - N-terminal region; anti-COX4I1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALK
Sequence Length
169
Applicable Applications for anti-COX4I1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 85%; Rabbit: 86%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human COX4I1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-COX4I1 Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysateCOX4I1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

product-image-AAA23506_WB6.jpg WB (Western Blot) (WB Suggested Anti-COX4I1 Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysateCOX4I1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

WB (Western Blot)

(Lanes:Lane 1: 50ug HeLa lysateLane 2: 50ug 293T lysateLane 3: 50ug K562 lysateLane 4: 50ug MDA-MB-231 lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:1000Gene Name:COX4I1Submitted by:David Colecchia, Ph.D, Istituto Toscano Tumori, Core Research Laboratory, presso Fondazione Toscana Life Sciences)

product-image-AAA23506_WB5.jpg WB (Western Blot) (Lanes:Lane 1: 50ug HeLa lysateLane 2: 50ug 293T lysateLane 3: 50ug K562 lysateLane 4: 50ug MDA-MB-231 lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:1000Gene Name:COX4I1Submitted by:David Colecchia, Ph.D, Istituto Toscano Tumori, Core Research Laboratory, presso Fondazione Toscana Life Sciences)

WB (Western Blot)

(COX4I1 antibody - N-terminal region validated by WB using 1. Human liver2. Rat liver3. Wild-type mouse liver4. AMPKa1+2-/- mouse liver5. Human muscle6. Rat muscle7. Mouse muscle at 1:1000.)

product-image-AAA23506_WB4.jpg WB (Western Blot) (COX4I1 antibody - N-terminal region validated by WB using 1. Human liver2. Rat liver3. Wild-type mouse liver4. AMPKa1+2-/- mouse liver5. Human muscle6. Rat muscle7. Mouse muscle at 1:1000.)

IHC (Immunohistochemistry)

(Rabbit Anti-COX4I1 AntibodyParaffin Embedded Tissue: Human cardiac cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA23506_IHC3.jpg IHC (Immunohistochemistry) (Rabbit Anti-COX4I1 AntibodyParaffin Embedded Tissue: Human cardiac cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IHC (Immunohistochemistry)

(Human kidney)

product-image-AAA23506_IHC2.jpg IHC (Immunohistochemistry) (Human kidney)

IHC (Immunohistochemistry)

(Human Heart)

product-image-AAA23506_IHC.jpg IHC (Immunohistochemistry) (Human Heart)
Related Product Information for anti-COX4I1 antibody
This is a rabbit polyclonal antibody against COX4I1. It was validated on Western Blot and immunohistochemistry

Target Description: Cytochrome c oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer and proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. COX4I1 is the nuclear-encoded subunit IV isoform 1 of the human mitochondrial respiratory chain enzyme.Cytochrome c oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer and proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. This gene encodes the nuclear-encoded subunit IV isoform 1 of the human mitochondrial respiratory chain enzyme. It is located at the 3' of the NOC4 (neighbor of COX4) gene in a head-to-head orientation, and shares a promoter with it.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19kDa
NCBI Official Full Name
cytochrome c oxidase subunit 4 isoform 1, mitochondrial isoform 1
NCBI Official Synonym Full Names
cytochrome c oxidase subunit 4I1
NCBI Official Symbol
COX4I1
NCBI Official Synonym Symbols
COX4; COXIV; COX4-1; COXIV-1; COX IV-1
NCBI Protein Information
cytochrome c oxidase subunit 4 isoform 1, mitochondrial
UniProt Protein Name
Cytochrome c oxidase subunit 4 isoform 1, mitochondrial
UniProt Gene Name
COX4I1
UniProt Synonym Gene Names
COX4; COX IV-1
UniProt Entry Name
COX41_HUMAN

Similar Products

Product Notes

The COX4I1 cox4i1 (Catalog #AAA23506) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The COX4I1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's COX4I1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the COX4I1 cox4i1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AISTSVCVRA HESVVKSEDF SLPAYMDRRD HPLPEVAHVK HLSASQKALK. It is sometimes possible for the material contained within the vial of "COX4I1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.