Rabbit DBI Polyclonal Antibody | anti-DBI antibody

DBI Polyclonal Antibody

Cat. Num. AAA28262

• Gene Names: DBI; EP; ACBP; ACBD1; CCK-RP
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunocytochemistry, Immunoprecipitation, ELISA
• Purity: Affinity Purification
• Synonyms: DBI, Antibody; DBI Polyclonal Antibody; ACBD1; ACBP; CCK-RP; EP; anti-DBI antibody

• Host: Rabbit
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity Purification
• Form/Format: PBS with 0.05% proclin300,50% glycerol,pH7.3.
• Sequence: MWGDLWLLPPASANPGTGTEAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI
• Sequence Length: 87

• Applicable Applications for anti-DBI antibody: Western Blot (WB), Immunohistochemistry Paraffin (IHC-P), Immunofluorescence (IF), Immunocytochemistry (ICC), Immunoprecipitation (IP), ELISA (EIA)
• Application Notes: WB: 1:500 - 1:1000; IHC-P: 1:50 - 1:200; IF/ICC: 1:50 - 1:200; IP: 0.5 ug- 4 ug antibody for 200 ug- 400 ug extracts of whole cells
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-104 of human DBI (NP_001171513.1).
• Preparation and Storage: Store at -20°C. Avoid freeze / thaw cycles.

IP (Immunoprecipitation)

(Immunoprecipitation analysis of 300 ?g extracts of HeLa cells using 3 ?g DBI antibody (AAA28262). Western blot was performed from the immunoprecipitate using DBI antibody (AAA28262) at a dilution of 1:1000.)

IF (Immunofluorescence)

(Immunofluorescence analysis of U2OS cells using DBI Rabbit pAb (AAA28262) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of PC-12 cells using DBI Rabbit pAb (AAA28262) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of NIH/3T3 cells using DBI Rabbit pAb (AAA28262) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of A-549 cells using DBI Rabbit pAb (AAA28262) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of DBI in paraffin-embedded rat ovary using DBI Rabbit pAb (AAA28262) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of DBI in paraffin-embedded rat liver using DBI Rabbit pAb (AAA28262) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

WB (Western Blot)

(Western blot analysis of various lysates using DBI Rabbit pAb (AAA28262) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25?g per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.)

WB (Western Blot)

(Western blot analysis of various lysates using DBI Rabbit pAb (AAA28262) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25?g per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic KitExposure time: 1s.)

IF (Immunofluorescence)

(Immunofluorescence analysis of MCF-7 cells using DBI antibody. Blue: DAPI for nuclear staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded mouse brain using DBI Antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human prostate using DBI Antibody at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using DBI antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)

Related Product Information for anti-DBI antibody

This gene encodes diazepam binding inhibitor, a protein that is regulated by hormones and is involved in lipid metabolism and the displacement of beta-carbolines and benzodiazepines, which modulate signal transduction at type A gamma-aminobutyric acid receptors located in brain synapses. The protein is conserved from yeast to mammals, with the most highly conserved domain consisting of seven contiguous residues that constitute the hydrophobic binding site for medium- and long-chain acyl-Coenzyme A esters. Diazepam binding inhibitor is also known to mediate the feedback regulation of pancreatic secretion and the postprandial release of cholecystokinin, in addition to its role as a mediator in corticotropin-dependent adrenal steroidogenesis. Three pseudogenes located on chromosomes 6, 8 and 16 have been identified. Multiple transcript variants encoding different isoforms have been described for this gene.

Product Categories/Family for anti-DBI antibody

Polyclonal Antibodies

NCBI and Uniprot Product Information

• NCBI GI #: 120433590
• NCBI GeneID: 1622
• NCBI Accession #: NP_001073331.1
• NCBI GenBank Nucleotide #: NM_001079862.2
• UniProt Accession #: P07108; P08869; Q4VWZ6; Q53SQ7; Q6IB48; Q9UCI8; B8ZWD2; B8ZWD6; B8ZWD7
• Molecular Weight: Calculated: 10kDa; Observed: 11kDa
• NCBI Official Full Name: acyl-CoA-binding protein isoform 3
• NCBI Official Synonym Full Names: diazepam binding inhibitor, acyl-CoA binding protein
• NCBI Official Symbol: DBI
• NCBI Official Synonym Symbols: EP; ACBP; ACBD1; CCK-RP
• NCBI Protein Information: acyl-CoA-binding protein
• UniProt Protein Name: Acyl-CoA-binding protein
• UniProt Gene Name: DBI
• UniProt Synonym Gene Names: ACBP; DBI; EP