Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online
product-image-AAA23608_WB6.jpg WB (Western Blot) (WB Suggested Anti-GABRP AntibodyTitration: 1.25 ug/mlPositive Control: HepG2/Jurkat)

Rabbit GABRP Polyclonal Antibody | anti-GABRP antibody

GABRP antibody - N-terminal region

Reactivity
Dog, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
GABRP, Antibody; GABRP antibody - N-terminal region; anti-GABRP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VEVGRSDKLSLPGFENLTAGYNKFLRPNFGGEPVQIALTLDIASISSISE
Sequence Length
440
Applicable Applications for anti-GABRP antibody
Western Blot (WB)
Homology
Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GABRP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-GABRP AntibodyTitration: 1.25 ug/mlPositive Control: HepG2/Jurkat)

product-image-AAA23608_WB6.jpg WB (Western Blot) (WB Suggested Anti-GABRP AntibodyTitration: 1.25 ug/mlPositive Control: HepG2/Jurkat)

WB (Western Blot)

(Host: RabbitTarget Name: GABRPSample Type: JurkatLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1.0ug/mLPeptide Concentration: 1.0ug/mLLysate Quantity: 25ug/laneGel Concentration: 12%)

product-image-AAA23608_WB5.jpg WB (Western Blot) (Host: RabbitTarget Name: GABRPSample Type: JurkatLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1.0ug/mLPeptide Concentration: 1.0ug/mLLysate Quantity: 25ug/laneGel Concentration: 12%)

WB (Western Blot)

(Host: RabbitTarget Name: GABRPSample Tissue: Human THP-1 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA23608_WB4.jpg WB (Western Blot) (Host: RabbitTarget Name: GABRPSample Tissue: Human THP-1 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: GABRPSample Tissue: Human HepG2 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA23608_WB3.jpg WB (Western Blot) (Host: RabbitTarget Name: GABRPSample Tissue: Human HepG2 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: GABRPSample Tissue: Human HepG2 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA23608_WB2.jpg WB (Western Blot) (Host: RabbitTarget Name: GABRPSample Tissue: Human HepG2 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: GABRPSample Tissue: Human 293TAntibody Dilution: 1.0ug/ml)

product-image-AAA23608_WB.jpg WB (Western Blot) (Host: RabbitTarget Name: GABRPSample Tissue: Human 293TAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-GABRP antibody
This is a rabbit polyclonal antibody against GABRP. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. The subunit encoded by this gene is expressed in several non-neuronal tissues including the uterus and ovaries. This subunit can assemble with known GABA A receptor subunits, and the presence of this subunit alters the sensitivity of recombinant receptors to modulatory agents such as pregnanolone.
Product Categories/Family for anti-GABRP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51kDa
NCBI Official Full Name
gamma-aminobutyric acid receptor subunit pi isoform 1
NCBI Official Synonym Full Names
gamma-aminobutyric acid type A receptor pi subunit
NCBI Official Symbol
GABRP
NCBI Protein Information
gamma-aminobutyric acid receptor subunit pi
UniProt Protein Name
Gamma-aminobutyric acid receptor subunit pi
UniProt Gene Name
GABRP
UniProt Entry Name
GBRP_HUMAN

Similar Products

Product Notes

The GABRP gabrp (Catalog #AAA23608) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GABRP antibody - N-terminal region reacts with Dog, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GABRP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GABRP gabrp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VEVGRSDKLS LPGFENLTAG YNKFLRPNFG GEPVQIALTL DIASISSISE. It is sometimes possible for the material contained within the vial of "GABRP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.