Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23595_WB6.jpg WB (Western Blot) (Lanes:Lane1: 400ug rat hippocampalLane2: 300ug rat hippocampalLane3: 200ug rat hippocampalLane4: 100ug rat hippocampalPrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:8000Gene Name:GPM6ASubmitted by:Anonymous)

Rabbit GPM6A Polyclonal Antibody | anti-GPM6A antibody

GPM6A antibody - C-terminal region

Gene Names
GPM6A; M6A; GPM6
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
GPM6A, Antibody; GPM6A antibody - C-terminal region; anti-GPM6A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IAMVHYLMVLSANWAYVKDACRMQKYEDIKSKEEQELHDIHSTRSKERLN
Sequence Length
278
Applicable Applications for anti-GPM6A antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Lanes:Lane1: 400ug rat hippocampalLane2: 300ug rat hippocampalLane3: 200ug rat hippocampalLane4: 100ug rat hippocampalPrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:8000Gene Name:GPM6ASubmitted by:Anonymous)

product-image-AAA23595_WB6.jpg WB (Western Blot) (Lanes:Lane1: 400ug rat hippocampalLane2: 300ug rat hippocampalLane3: 200ug rat hippocampalLane4: 100ug rat hippocampalPrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:8000Gene Name:GPM6ASubmitted by:Anonymous)

WB (Western Blot)

(Lanes:Lane1: 250ug rat hippocampal culture neuronsLane2: 200ug rat hippocampal culture neuronsLane3: 100ug rat hippocampal culture neuronsLane4: 50ug rat hippocampal culture neuronsPrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:8000Gene Name:GPM6ASubmitted by:Anonymous)

product-image-AAA23595_WB5.jpg WB (Western Blot) (Lanes:Lane1: 250ug rat hippocampal culture neuronsLane2: 200ug rat hippocampal culture neuronsLane3: 100ug rat hippocampal culture neuronsLane4: 50ug rat hippocampal culture neuronsPrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:8000Gene Name:GPM6ASubmitted by:Anonymous)

WB (Western Blot)

(Host: RabbitTarget Name: GPM6ASample Tissue: Human BrainAntibody Dilution: 1ug/ml)

product-image-AAA23595_WB4.jpg WB (Western Blot) (Host: RabbitTarget Name: GPM6ASample Tissue: Human BrainAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: GPM6AAntibody Dilution: 1.0ug/mlSample Type: Human brain)

product-image-AAA23595_WB3.jpg WB (Western Blot) (Host: RabbitTarget Name: GPM6AAntibody Dilution: 1.0ug/mlSample Type: Human brain)

IHC (Immunohistochemistry)

(Primary Antibody Dilution :1:250Secondary Antibody :Anti-rabbit-AlexaFluor 488Secondary Antibody Dilution :1:1000Color/Signal Descriptions :GPM6A: Green DAPI: BlueGene Name :GPM6ASubmitted by :Anonymous)

product-image-AAA23595_IHC2.jpg IHC (Immunohistochemistry) (Primary Antibody Dilution :1:250Secondary Antibody :Anti-rabbit-AlexaFluor 488Secondary Antibody Dilution :1:1000Color/Signal Descriptions :GPM6A: Green DAPI: BlueGene Name :GPM6ASubmitted by :Anonymous)

IHC (Immunohistochemistry)

(Primary Antibody Dilution :1:250Secondary Antibody :Anti-rabbit-AlexaFluor 488Secondary Antibody Dilution :1:1000Color/Signal Descriptions :GPM6A: Green DAPI: BlueGene Name :GPM6ASubmitted by :Anonymous)

product-image-AAA23595_IHC.jpg IHC (Immunohistochemistry) (Primary Antibody Dilution :1:250Secondary Antibody :Anti-rabbit-AlexaFluor 488Secondary Antibody Dilution :1:1000Color/Signal Descriptions :GPM6A: Green DAPI: BlueGene Name :GPM6ASubmitted by :Anonymous)
Related Product Information for anti-GPM6A antibody
This is a rabbit polyclonal antibody against GPM6A. It was validated on Western Blot

Target Description: The function of this protein remains unknown.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31kDa
NCBI Official Full Name
neuronal membrane glycoprotein M6-a isoform 1
NCBI Official Synonym Full Names
glycoprotein M6A
NCBI Official Symbol
GPM6A
NCBI Official Synonym Symbols
M6A; GPM6
NCBI Protein Information
neuronal membrane glycoprotein M6-a
UniProt Protein Name
Neuronal membrane glycoprotein M6-a
UniProt Gene Name
GPM6A
UniProt Synonym Gene Names
M6A; M6a
UniProt Entry Name
GPM6A_HUMAN

Similar Products

Product Notes

The GPM6A gpm6a (Catalog #AAA23595) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GPM6A antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GPM6A can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the GPM6A gpm6a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IAMVHYLMVL SANWAYVKDA CRMQKYEDIK SKEEQELHDI HSTRSKERLN. It is sometimes possible for the material contained within the vial of "GPM6A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.