Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23517_WB7.jpg WB (Western Blot) (WB Suggested Anti-HGF Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysateThere is BioGPS gene expression data showing that HGF is expressed in HEK293T)

Rabbit HGF Polyclonal Antibody | anti-HGF antibody

HGF antibody - N-terminal region

Gene Names
HGF; SF; HGFB; HPTA; F-TCF; DFNB39
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
HGF, Antibody; HGF antibody - N-terminal region; anti-HGF antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Clonality
Polyclonal
Specificity
100% homologous to all 6 isoforms; 1 (83kDa), 2 (34kDa), 3 (83kDa), 4 (35kDa), 5 (33kDa), 6 (24kDa)
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and may contain up to 2% sucrose.
Sequence
Synthetic peptide located within the following region: VKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIP
Sequence Length
728
Applicable Applications for anti-HGF antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human HGF
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-HGF Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysateThere is BioGPS gene expression data showing that HGF is expressed in HEK293T)

product-image-AAA23517_WB7.jpg WB (Western Blot) (WB Suggested Anti-HGF Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysateThere is BioGPS gene expression data showing that HGF is expressed in HEK293T)

WB (Western Blot)

(Host: RabbitTarget Name: HGFSample Type: Human HepG2 cellLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5.0 ug/mlLysate Quantity: 25ug/lane/laneGel Concentration: 12%)

product-image-AAA23517_WB6.jpg WB (Western Blot) (Host: RabbitTarget Name: HGFSample Type: Human HepG2 cellLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5.0 ug/mlLysate Quantity: 25ug/lane/laneGel Concentration: 12%)

WB (Western Blot)

(Host: RabbitTarget Name: HGFSample Type: 721_B Whole Cell lysatesAntibody Dilution: 0.5ug/ml)

product-image-AAA23517_WB5.jpg WB (Western Blot) (Host: RabbitTarget Name: HGFSample Type: 721_B Whole Cell lysatesAntibody Dilution: 0.5ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: HGFSample Type: 721_B Cell lysatesAntibody Dilution: 1.0ug/ml)

product-image-AAA23517_WB4.jpg WB (Western Blot) (Host: RabbitTarget Name: HGFSample Type: 721_B Cell lysatesAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: HGFSample Type: 293T Whole Cell lysatesAntibody Dilution: 0.2ug/ml)

product-image-AAA23517_WB3.jpg WB (Western Blot) (Host: RabbitTarget Name: HGFSample Type: 293T Whole Cell lysatesAntibody Dilution: 0.2ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: HGFSample Type: 293T Whole Cell lysatesAntibody Dilution: 0.2ug/ml)

product-image-AAA23517_WB2.jpg WB (Western Blot) (Host: RabbitTarget Name: HGFSample Type: 293T Whole Cell lysatesAntibody Dilution: 0.2ug/ml)

IHC (Immunohistochemistry)

(Immunohistochemistry with Human Adrenal Gland lysate tissue at an antibody concentration of 5.0ug/ml using anti-HGF antibody)

product-image-AAA23517_IHC.jpg IHC (Immunohistochemistry) (Immunohistochemistry with Human Adrenal Gland lysate tissue at an antibody concentration of 5.0ug/ml using anti-HGF antibody)
Related Product Information for anti-HGF antibody
This is a rabbit polyclonal antibody against HGF. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Hepatocyte growth factor regulates cell growth, cell motility, and morphogenesis by activating a tyrosine kinase signaling cascade after binding to the proto-oncogenic c-Met receptor. Hepatocyte growth factor is secreted by mesenchymal cells and acts as a multi-functional cytokine on cells of mainly epithelial origin. Its ability to stimulate mitogenesis, cell motility, and matrix invasion gives it a central role in angiogenesis, tumorogenesis, and tissue regeneration. It is secreted as a single inactive polypeptide and is cleaved by serine proteases into a 69-kDa alpha-chain and 34-kDa beta-chain. A disulfide bond between the alpha and beta chains produces the active, heterodimeric molecule. The protein belongs to the plasminogen subfamily of S1 peptidases but has no detectable protease activity.Hepatocyte growth factor regulates cell growth, cell motility, and morphogenesis by activating a tyrosine kinase signaling cascade after binding to the proto-oncogenic c-Met receptor. Hepatocyte growth factor is secreted by mesenchymal cells and acts as a multi-functional cytokine on cells of mainly epithelial origin. Its ability to stimulate mitogenesis, cell motility, and matrix invasion gives it a central role in angiogenesis, tumorogenesis, and tissue regeneration. It is secreted as a single inactive polypeptide and is cleaved by serine proteases into a 69-kDa alpha-chain and 34-kDa beta-chain. A disulfide bond between the alpha and beta chains produces the active, heterodimeric molecule. The protein belongs to the plasminogen subfamily of S1 peptidases but has no detectable protease activity. Alternative splicing of this gene produces multiple transcript variants encoding different isoforms.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
83kDa
NCBI Official Full Name
hepatocyte growth factor isoform 3 preproprotein
NCBI Official Synonym Full Names
hepatocyte growth factor
NCBI Official Symbol
HGF
NCBI Official Synonym Symbols
SF; HGFB; HPTA; F-TCF; DFNB39
NCBI Protein Information
hepatocyte growth factor
UniProt Protein Name
Hepatocyte growth factor
UniProt Gene Name
HGF
UniProt Synonym Gene Names
HPTA; SF
UniProt Entry Name
HGF_HUMAN

Similar Products

Product Notes

The HGF hgf (Catalog #AAA23517) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HGF antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's HGF can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the HGF hgf for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VKKEFGHEFD LYENKDYIRN CIIGKGRSYK GTVSITKSGI KCQPWSSMIP. It is sometimes possible for the material contained within the vial of "HGF, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.