Loading...

Skip to main content

Call us at +1-800-604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse spleen using HMGN1 antibody at dilution of 1:100 (40x lens).)

Rabbit anti-Mouse, Rat HMGN1 Polyclonal Antibody | anti-HMGN1 antibody

HMGN1 Polyclonal Antibody

Gene Names
HMGN1; HMG14
Reactivity
Mouse, Rat
Applications
Immunohistochemistry
Purity
Affinity Purification
Synonyms
HMGN1, Antibody; HMGN1 Polyclonal Antibody; HMG14; anti-HMGN1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MPKRKVSSAEGAAKEEPKRRSARLSAKPPAKVEAKPKKAAAKDKSSDKKVQTKGKRGAKGKQAEVANQETKEDLPAENGETKTEESPASDEAGEKEAKSD
Sequence Length
100
Applicable Applications for anti-HMGN1 antibody
Immunohistochemistry (IHC)
Application Notes
IHC: 1:50 - 1:200
Immunogen
Recombinant protein of human HMGN1
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cytoplasm, Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded mouse spleen using HMGN1 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse spleen using HMGN1 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistchemistry)

(Immunohistochemistry of paraffin-embedded mouse brain using HMGN1 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistchemistry) (Immunohistochemistry of paraffin-embedded mouse brain using HMGN1 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded mouse liver using HMGN1 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse liver using HMGN1 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded mouse testis using HMGN1 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse testis using HMGN1 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded rat spleen using HMGN1 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded rat spleen using HMGN1 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded rat brain using HMGN1 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded rat brain using HMGN1 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded rat liver using HMGN1 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded rat liver using HMGN1 antibody at dilution of 1:100 (40x lens).)
Related Product Information for anti-HMGN1 antibody
The protein encoded by this gene binds nucleosomal DNA and is associated with transcriptionally active chromatin. Along with a similar protein, HMG17, the encoded protein may help maintain an open chromatin configuration around transcribable genes.
Product Categories/Family for anti-HMGN1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
10kDa
NCBI Official Full Name
non-histone chromosomal protein HMG-14
NCBI Official Synonym Full Names
high mobility group nucleosome binding domain 1
NCBI Official Symbol
HMGN1
NCBI Official Synonym Symbols
HMG14
NCBI Protein Information
non-histone chromosomal protein HMG-14
UniProt Protein Name
Non-histone chromosomal protein HMG-14
UniProt Gene Name
HMGN1
UniProt Synonym Gene Names
HMG14

Similar Products

Product Notes

The HMGN1 hmgn1 (Catalog #AAA28278) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HMGN1 Polyclonal Antibody reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HMGN1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC). IHC: 1:50 - 1:200. Researchers should empirically determine the suitability of the HMGN1 hmgn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MPKRKVSSAE GAAKEEPKRR SARLSAKPPA KVEAKPKKAA AKDKSSDKKV QTKGKRGAKG KQAEVANQET KEDLPAENGE TKTEESPASD EAGEKEAKSD. It is sometimes possible for the material contained within the vial of "HMGN1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.