Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online
product-image-AAA11683_IHC6.jpg IHC (Immunohistchemistry) (HnRNP A1 was detected in paraffin-embedded sections of human placenta tissues using rabbit anti- HnRNP A1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

Rabbit HnRNP A1 Polyclonal Antibody | anti-HNRNPA1 antibody

Anti-HnRNP A1 Antibody

Gene Names
HNRNPA1; UP 1; ALS19; ALS20; HNRPA1; IBMPFD3; HNRPA1L3; hnRNP A1; hnRNP-A1
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Immunogen affinity purified.
Synonyms
HnRNP A1, Antibody; Anti-HnRNP A1 Antibody; ALS19; ALS20; HNRNPA 1; HNRNPA1; hnRNP A1; HNRPA1; UP 1; IBMPFD3; HNRPA1L3; P09651; Heterogeneous nuclear ribonucleoprotein A1; anti-HNRNPA1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
320
Applicable Applications for anti-HNRNPA1 antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes
Western Blot: 0.1-0.5ug/ml
Immunohistochemistry(IHC) Paraffin: 0.5-1ug/ml
Notes
Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human HnRNP A1 (8-42aa KEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTD), identical to the related mouse and rat sequences.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistchemistry)

(HnRNP A1 was detected in paraffin-embedded sections of human placenta tissues using rabbit anti- HnRNP A1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA11683_IHC6.jpg IHC (Immunohistchemistry) (HnRNP A1 was detected in paraffin-embedded sections of human placenta tissues using rabbit anti- HnRNP A1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

IHC (Immunohistochemistry)

(HnRNP A1 was detected in paraffin-embedded sections of human intestinal cancer tissues using rabbit anti- HnRNP A1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA11683_IHC5.jpg IHC (Immunohistochemistry) (HnRNP A1 was detected in paraffin-embedded sections of human intestinal cancer tissues using rabbit anti- HnRNP A1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

IHC (Immunohistochemistry)

(HnRNP A1 was detected in paraffin-embedded sections of rat kidney tissues using rabbit anti- HnRNP A1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA11683_IHC4.jpg IHC (Immunohistochemistry) (HnRNP A1 was detected in paraffin-embedded sections of rat kidney tissues using rabbit anti- HnRNP A1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

IHC (Immunohistochemistry)

(HnRNP A1 was detected in paraffin-embedded sections of mouse kidney tissues using rabbit anti- HnRNP A1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA11683_IHC3.jpg IHC (Immunohistochemistry) (HnRNP A1 was detected in paraffin-embedded sections of mouse kidney tissues using rabbit anti- HnRNP A1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

IHC (Immunohistochemistry)

(HnRNP A1 was detected in paraffin-embedded sections of mouse intestine tissues using rabbit anti- HnRNP A1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA11683_IHC2.jpg IHC (Immunohistochemistry) (HnRNP A1 was detected in paraffin-embedded sections of mouse intestine tissues using rabbit anti- HnRNP A1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

WB (Western Blot)

(Western blot analysis of HnRNP A1 expression in rat liver extract (lane 1), mouse thymus extract (lane 2) and HELA whole cell lysates (lane 3). HnRNP A1 at 39KD was detected using rabbit anti- HnRNP A1 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.)

product-image-AAA11683_WB.jpg WB (Western Blot) (Western blot analysis of HnRNP A1 expression in rat liver extract (lane 1), mouse thymus extract (lane 2) and HELA whole cell lysates (lane 3). HnRNP A1 at 39KD was detected using rabbit anti- HnRNP A1 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.)
Related Product Information for anti-HNRNPA1 antibody
Rabbit IgG polyclonal antibody for Heterogeneous nuclear ribonucleoprotein A1(HNRNPA1) detection.
Background: Heterogeneous nuclear ribonucleoprotein A1 is a protein that in humans is encoded by the HNRNPA1 gene. This gene encodes a member of a family of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs), which are RNA-binding proteins that associate with pre-mRNAs in the nucleus and influence pre-mRNA processing, as well as other aspects of mRNA metabolism and transport. The protein encoded by this gene is one of the most abundant core proteins of hnRNP complexes and plays a key role in the regulation of alternative splicing. Mutations in this gene have been observed in individuals with amyotrophic lateral sclerosis 20. Multiple alternatively spliced transcript variants have been found. There are numerous pseudogenes of this gene distributed throughout the genome.
References
1. "Entrez Gene: HNRPA1 heterogeneous nuclear ribonucleoprotein A1".
2. Biamonti G, Buvoli M, Bassi MT, Morandi C, Cobianchi F, Riva S (1989). "Isolation of an active gene encoding human hnRNP protein A1. Evidence for alternative splicing.". J. Mol. Biol. 207 (3): 491-503.
3. Saccone S, Biamonti G, Maugeri S, Bassi MT, Bunone G, Riva S, Della Valle G (Mar 1992). "Assignment of the human heterogeneous nuclear ribonucleoprotein A1 gene (HNRPA1) to chromosome 12q13.1 by cDNA competitive in situ hybridization". Genomics. 12 (1): 171-4.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29,386 Da
NCBI Official Full Name
heterogeneous nuclear ribonucleoprotein A1 isoform a
NCBI Official Synonym Full Names
heterogeneous nuclear ribonucleoprotein A1
NCBI Official Symbol
HNRNPA1
NCBI Official Synonym Symbols
UP 1; ALS19; ALS20; HNRPA1; IBMPFD3; HNRPA1L3; hnRNP A1; hnRNP-A1
NCBI Protein Information
heterogeneous nuclear ribonucleoprotein A1
UniProt Protein Name
Heterogeneous nuclear ribonucleoprotein A1
UniProt Gene Name
HNRNPA1
UniProt Synonym Gene Names
HNRPA1; hnRNP A1

Similar Products

Product Notes

The HNRNPA1 hnrnpa1 (Catalog #AAA11683) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-HnRNP A1 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HnRNP A1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC) Paraffin. Western Blot: 0.1-0.5ug/ml Immunohistochemistry(IHC) Paraffin: 0.5-1ug/ml. Researchers should empirically determine the suitability of the HNRNPA1 hnrnpa1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HnRNP A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.