Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23481_WB6.jpg WB (Western Blot) (WB Suggested Anti-IGF2BP2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HT1080 cell lysateIGF2BP2 is supported by BioGPS gene expression data to be expressed in HT1080)

Rabbit IGF2BP2 Polyclonal Antibody | anti-IGF2BP2 antibody

IGF2BP2 antibody - middle region

Gene Names
IGF2BP2; IMP2; IMP-2; VICKZ2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
IGF2BP2, Antibody; IGF2BP2 antibody - middle region; anti-IGF2BP2 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QANLIPGLNLSALGIFSTGLSVLSPPAGPRGAPPAAPYHPFTTHSGYFSS
Sequence Length
599
Applicable Applications for anti-IGF2BP2 antibody
WB (Western Blot)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 79%; Rabbit: 93%; Rat: 100%; Yeast: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human IGF2BP2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-IGF2BP2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HT1080 cell lysateIGF2BP2 is supported by BioGPS gene expression data to be expressed in HT1080)

product-image-AAA23481_WB6.jpg WB (Western Blot) (WB Suggested Anti-IGF2BP2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HT1080 cell lysateIGF2BP2 is supported by BioGPS gene expression data to be expressed in HT1080)

WB (Western Blot)

(Host: RabbitTarget Name: IGF2BP2Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

product-image-AAA23481_WB5.jpg WB (Western Blot) (Host: RabbitTarget Name: IGF2BP2Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: IGF2BP2Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

product-image-AAA23481_WB4.jpg WB (Western Blot) (Host: RabbitTarget Name: IGF2BP2Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: IGF2BP2Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

product-image-AAA23481_WB3.jpg WB (Western Blot) (Host: RabbitTarget Name: IGF2BP2Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: IGF2BP2Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

product-image-AAA23481_WB2.jpg WB (Western Blot) (Host: RabbitTarget Name: IGF2BP2Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: IGF2BP2Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

product-image-AAA23481_WB.jpg WB (Western Blot) (Host: RabbitTarget Name: IGF2BP2Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-IGF2BP2 antibody
This is a rabbit polyclonal antibody against IGF2BP2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: IGF2BP2 binds to the 5'-UTR of the insulin-like growth factor 2 (IGF2) mRNAs. Binding is isoform-specific. IGF2BP2 may regulate translation of target mRNAs.
Product Categories/Family for anti-IGF2BP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
66kDa
NCBI Official Full Name
insulin-like growth factor 2 mRNA-binding protein 2 isoform b
NCBI Official Synonym Full Names
insulin like growth factor 2 mRNA binding protein 2
NCBI Official Symbol
IGF2BP2
NCBI Official Synonym Symbols
IMP2; IMP-2; VICKZ2
NCBI Protein Information
insulin-like growth factor 2 mRNA-binding protein 2
UniProt Protein Name
Insulin-like growth factor 2 mRNA-binding protein 2
UniProt Gene Name
IGF2BP2
UniProt Synonym Gene Names
IMP2; VICKZ2; IGF2 mRNA-binding protein 2; IMP-2
UniProt Entry Name
IF2B2_HUMAN

Similar Products

Product Notes

The IGF2BP2 igf2bp2 (Catalog #AAA23481) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IGF2BP2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's IGF2BP2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the IGF2BP2 igf2bp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QANLIPGLNL SALGIFSTGL SVLSPPAGPR GAPPAAPYHP FTTHSGYFSS. It is sometimes possible for the material contained within the vial of "IGF2BP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.