Rabbit anti-Human JAK2 Polyclonal Antibody | anti-JAK2 antibody

JAK2 Rabbit pAb

Cat. Num. AAA28625

• Reactivity: Human
• Applications: Immunohistochemistry, Immunofluorescence, Immunocytochemistry, ELISA
• Purity: Affinity purification
• Synonyms: JAK2, Antibody; JAK2 Rabbit pAb; JTK10; JAK2; anti-JAK2 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity purification
• Form/Format: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
• Sequence: YEPDFRPSFRAIIRDLNSLFTPDYELLTENDMLPNMRIGALGFSGAFEDRDPTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEE

• Applicable Applications for anti-JAK2 antibody: Immunohistochemistry-Paraffin (IHC-P), Immunofluorescence (IF), Immunocytochemistry (ICC), ELISA (EIA)
• Application Notes: IHC-P: 1:50-1:200; IF/ICC: 1:50-1:200; ELISA: Recommended starting concentration is 1ug/mL.; Please optimize the concentration based on your specific assay requirements.
• Cross Reactivity: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 790-890 of human JAK2 (NP_004963.1).
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of U-2 OS cells using JAK2 Rabbit pAb(AAA28625) at a dilution of 1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using JAK2 Rabbit pAb (AAA28625) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using JAK2 Rabbit pAb (AAA28625) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using JAK2 Rabbit pAb (AAA28625) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat spleen tissue using JAK2 Rabbit pAb (AAA28625) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat spleen tissue using JAK2 Rabbit pAb (AAA28625) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

Related Product Information for anti-JAK2 antibody

This gene encodes a non-receptor tyrosine kinase that plays a central role in cytokine and growth factor signalling. The primary isoform of this protein has an N-terminal FERM domain that is required for erythropoietin receptor association, an SH2 domain that binds STAT transcription factors, a pseudokinase domain and a C-terminal tyrosine kinase domain. Cytokine binding induces autophosphorylation and activation of this kinase. This kinase then recruits and phosphorylates signal transducer and activator of transcription (STAT) proteins. Growth factors like TGF-beta 1 also induce phosphorylation and activation of this kinase and translocation of downstream STAT proteins to the nucleus where they influence gene transcription. Mutations in this gene are associated with numerous inflammatory diseases and malignancies. This gene is a downstream target of the pleiotropic cytokine IL6 that is produced by B cells, T cells, dendritic cells and macrophages to produce an immune response or inflammation. Disregulation of the IL6/JAK2/STAT3 signalling pathways produces increased cellular proliferation and myeloproliferative neoplasms of hematopoietic stem cells. A nonsynonymous mutation in the pseudokinase domain of this gene disrupts the domains inhibitory effect and results in constitutive tyrosine phosphorylation activity and hypersensitivity to cytokine signalling. This gene and the IL6/JAK2/STAT3 signalling pathway is a therapeutic target for the treatment of excessive inflammatory responses to viral infections. Alternative splicing results in multiple transcript variants encoding distinct isoforms.

Product Categories/Family for anti-JAK2 antibody

Epigenetics Nuclear Signaling; Epigenetic writers and erasers of core Histones; Protein phosphorylation; Cancer; Signal Transduction; Kinase; Tyrosine kinases; ErbB-HER Signaling Pathway; Cell Biology Developmental Biology; Apoptosis; Inhibition of Apopto

NCBI and Uniprot Product Information

• NCBI GI #: 4826776
• NCBI GeneID: 3717
• NCBI Accession #: NP_004963.1
• NCBI GenBank Nucleotide #: NM_004972.3
• UniProt Accession #: O60674; O14636; O75297
• Molecular Weight: Calculated MW: 131kDa
• UniProt Protein Name: Tyrosine-protein kinase JAK2
• UniProt Gene Name: JAK2
• UniProt Synonym Gene Names: JAK-2
• UniProt Entry Name: JAK2_HUMAN