Loading...

Skip to main content

Call us at +1-800-604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

WB (Western Blot) (WB Suggested Anti-LYN Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysateLYN is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)

Rabbit LYN Polyclonal Antibody | anti-LYN antibody

LYN antibody - N-terminal region

Gene Names
LYN; JTK8; p53Lyn; p56Lyn
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LYN, Antibody; LYN antibody - N-terminal region; anti-LYN antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DPTSNKQQRPVPESQLLPGQRFQTKDPEEQGDIVVALYPYDGIHPDDLSF
Sequence Length
512
Applicable Applications for anti-LYN antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 93%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human LYN
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-LYN Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysateLYN is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)

WB (Western Blot) (WB Suggested Anti-LYN Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysateLYN is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)

WB (Western Blot)

(Host: RabbitTarget Name: LYNSample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot) (Host: RabbitTarget Name: LYNSample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: LYNSample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

WB (Western Blot) (Host: RabbitTarget Name: LYNSample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: LYNSample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

WB (Western Blot) (Host: RabbitTarget Name: LYNSample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: LYNSample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

WB (Western Blot) (Host: RabbitTarget Name: LYNSample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: LYNSample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

WB (Western Blot) (Host: MouseTarget Name: LYNSample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-LYN AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Appendix (Colon) TissueObserved Staining: Plasma membranePrimary Antibody Concentration: 1:600Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

IHC (Immunohistochemistry) (Rabbit Anti-LYN AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Appendix (Colon) TissueObserved Staining: Plasma membranePrimary Antibody Concentration: 1:600Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-LYN antibody
This is a rabbit polyclonal antibody against LYN. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: LYN down regulates expression of stem cell growth factor receptor (KIT).LYN acts as an effector of EpoR (erythropoietin receptor) in controlling KIT expression and may play a central role in erythroid differentiation during the switch between proliferation and maturation.LYN acts as a positive regulator of cell movement while negatively regulating adhesion to stromal cells by inhibiting the ICAM-1-binding activity of beta-2 integrins. LYN acts as the mediator that relays suppressing signals from the chemokine receptor CXCR4 to beta-2 integrin LFA-1 in hematopoietic precursors. Involved in induction of stress-activated protein kinase (SAPK), but not ERK or p38 MAPK, in response to genotoxic agents.LYN induces SAPK by a MKK7- and MEKK1-dependent mechanism. The LYN -> MEKK1 -> MKK7 -> SAPK pathway is functional in the induction of apoptosis by genotoxic agents.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58kDa
NCBI Official Full Name
tyrosine-protein kinase Lyn isoform A
NCBI Official Synonym Full Names
LYN proto-oncogene, Src family tyrosine kinase
NCBI Official Symbol
LYN
NCBI Official Synonym Symbols
JTK8; p53Lyn; p56Lyn
NCBI Protein Information
tyrosine-protein kinase Lyn
UniProt Protein Name
Tyrosine-protein kinase Lyn
UniProt Gene Name
LYN
UniProt Synonym Gene Names
JTK8
UniProt Entry Name
LYN_HUMAN

Similar Products

Product Notes

The LYN lyn (Catalog #AAA23560) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LYN antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's LYN can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LYN lyn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DPTSNKQQRP VPESQLLPGQ RFQTKDPEEQ GDIVVALYPY DGIHPDDLSF. It is sometimes possible for the material contained within the vial of "LYN, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.