Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online
product-image-AAA11691_FCM8.jpg FCM (Flow Cytometry) (Figure 8. Flow Cytometry analysis of U20S cells using anti-NFIA antibody (AAA11691).Overlay histogram showing U20S cells stained with AAA11691 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-NFIA Antibody (AAA11691,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

Rabbit NFIA Polyclonal Antibody | anti-NFIA antibody

Anti-NFIA Antibody

Gene Names
NFIA; CTF; NF1-A; NFI-A; NFI-L; NF-I/A
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Immunogen affinity purified.
Synonyms
NFIA, Antibody; Anti-NFIA Antibody; CTF; NF I/A; NF-I/A; NF1-A; NFI A; NFI L; NFI-A; NFIA; Q12857; Nuclear factor 1 A-type; nuclear factor I A; anti-NFIA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
509
Applicable Applications for anti-NFIA antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes
Western Blot: 0.1-0.5ug/ml
Immunohistochemistry(IHC) Paraffin: 0.5-1ug/ml
Notes
Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human NFIA (180-224aa AYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSG VFS), different from the related mouse sequence by one amino acid, and identical to the related rat sequence.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

FCM (Flow Cytometry)

(Figure 8. Flow Cytometry analysis of U20S cells using anti-NFIA antibody (AAA11691).Overlay histogram showing U20S cells stained with AAA11691 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-NFIA Antibody (AAA11691,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA11691_FCM8.jpg FCM (Flow Cytometry) (Figure 8. Flow Cytometry analysis of U20S cells using anti-NFIA antibody (AAA11691).Overlay histogram showing U20S cells stained with AAA11691 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-NFIA Antibody (AAA11691,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

FCM (Flow Cytometry)

(Figure 6. Flow Cytometry analysis of K562 cells using anti-NFIA antibody (AAA11691).Overlay histogram showing K562 cells stained with AAA11691 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-NFIA Antibody (AAA11691,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA11691_FCM6.jpg FCM (Flow Cytometry) (Figure 6. Flow Cytometry analysis of K562 cells using anti-NFIA antibody (AAA11691).Overlay histogram showing K562 cells stained with AAA11691 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-NFIA Antibody (AAA11691,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

WB (Western Blot)

(Figure 5. Western blot analysis of NFIA using anti- NFIA antibody (AAA11691).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: mouse HEPA1-6 whole cell lysates,Lane 2: mouse SP2/0 whole cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti- NFIA antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for NFIA at approximately 69KD. The expected band size for NFIA is at 56KD)

product-image-AAA11691_WB5.jpg WB (Western Blot) (Figure 5. Western blot analysis of NFIA using anti- NFIA antibody (AAA11691).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: mouse HEPA1-6 whole cell lysates,Lane 2: mouse SP2/0 whole cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti- NFIA antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for NFIA at approximately 69KD. The expected band size for NFIA is at 56KD)

IHC (Immunohistochemistry)

(Figure 4. IHC analysis of NFIA using anti- NFIA antibody (AAA11691).NFIA was detected in paraffin-embedded section of human mammary cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti- NFIA Antibody (AAA11691) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

product-image-AAA11691_IHC4.jpg IHC (Immunohistochemistry) (Figure 4. IHC analysis of NFIA using anti- NFIA antibody (AAA11691).NFIA was detected in paraffin-embedded section of human mammary cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti- NFIA Antibody (AAA11691) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 3. IHC analysis of NFIA using anti- NFIA antibody (AAA11691).NFIA was detected in paraffin-embedded section of rat liver tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti- NFIA Antibody (AAA11691) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

product-image-AAA11691_IHC3.jpg IHC (Immunohistochemistry) (Figure 3. IHC analysis of NFIA using anti- NFIA antibody (AAA11691).NFIA was detected in paraffin-embedded section of rat liver tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti- NFIA Antibody (AAA11691) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 2. IHC analysis of NFIA using anti- NFIA antibody (AAA11691).NFIA was detected in paraffin-embedded section of mouse liver tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti- NFIA Antibody (AAA11691) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

product-image-AAA11691_IHC2.jpg IHC (Immunohistochemistry) (Figure 2. IHC analysis of NFIA using anti- NFIA antibody (AAA11691).NFIA was detected in paraffin-embedded section of mouse liver tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti- NFIA Antibody (AAA11691) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

WB (Western Blot)

(Figure 1. Western blot analysis of NFIA using anti- NFIA antibody (AAA11691).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: JURKAT whole cell lysates,Lane 2: COLO320 whole cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti- NFIA antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for NFIA at approximately 69KD. The expected band size for NFIA is at 56KD.)

product-image-AAA11691_WB.jpg WB (Western Blot) (Figure 1. Western blot analysis of NFIA using anti- NFIA antibody (AAA11691).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: JURKAT whole cell lysates,Lane 2: COLO320 whole cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti- NFIA antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for NFIA at approximately 69KD. The expected band size for NFIA is at 56KD.)
Related Product Information for anti-NFIA antibody
Rabbit IgG polyclonal antibody for Nuclear factor 1 A-type(NFIA) detection.
Background: Nuclear factor 1 A-type is a protein that in humans is encoded by the NFIA gene. Nuclear factor I (NFI) proteins constitute a family of dimericDNA-binding proteins with similar, and possibly identical, DNA-binding specificity. They function as cellular transcription factors and as replication factors for adenovirus DNA replication. Diversity in this protein family is generated by multiple genes, differential splicing, and heterodimerization.
References
1. Leahy P, Crawford DR, Grossman G, et al. (1999). "CREB binding protein coordinates the function of multiple transcription factors including nuclear factor I to regulate phosphoenolpyruvate carboxykinase (GTP) gene transcription.". J. Biol. Chem. 274 (13): 8813-22.
2. Qian F, Kruse U, Lichter P, Sippel AE (Dec 1995). "Chromosomal localization of the four genes (NFIA, B, C, and X) for the human transcription factor nuclear factor I by FISH". Genomics 28 (1): 66-73.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60,894 Da
NCBI Official Full Name
nuclear factor 1 A-type isoform 1
NCBI Official Synonym Full Names
nuclear factor I A
NCBI Official Symbol
NFIA
NCBI Official Synonym Symbols
CTF; NF1-A; NFI-A; NFI-L; NF-I/A
NCBI Protein Information
nuclear factor 1 A-type
UniProt Protein Name
Nuclear factor 1 A-type
UniProt Gene Name
NFIA
UniProt Synonym Gene Names
KIAA1439; NF1-A; Nuclear factor 1/A; CTF; NF-I/A; NFI-A

Similar Products

Product Notes

The NFIA nfia (Catalog #AAA11691) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-NFIA Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NFIA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC) Paraffin. Western Blot: 0.1-0.5ug/ml Immunohistochemistry(IHC) Paraffin: 0.5-1ug/ml. Researchers should empirically determine the suitability of the NFIA nfia for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NFIA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.