<
IP (Immunoprecipitation)
(Immunoprecipitation analysis of 200 ug extracts of U-251MG cells using 3 ug S100A6 antibody (AAA28618). Western blot was performed from the immunoprecipitate using S100A6 antibody (AAA28618) at a dilution of 1:1000.)
Rabbit anti-Human S100A6 Polyclonal Antibody | anti-S100A6 antibody
S100A6 Rabbit pAb
Reactivity
Human
Applications
Western Blot, Immunohistochemistry, Immunofluorescence, Immunocytochemistry, Immunoprecipitation, ELISA
Purity
Affinity purification
Synonyms
S100A6, Antibody; S100A6 Rabbit pAb; 2A9; PRA; 5B10; CABP; CACY; S10A6; S100A6; anti-S100A6 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG
Applicable Applications for anti-S100A6 antibody
Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), Immunofluorescence (IF), Immunocytochemistry (ICC), Immunoprecipitation (IP), ELISA (EIA)
Application Notes
WB: 1:500-1:1000
IHC-P: 1:50-1:200
IF/ICC: 1:50-1:200
IP: 0.5ug-4ug antibody for 200ug-400ug extracts of whole cells
ELISA: Recommended starting concentration is 1ug/mL.
Please optimize the concentration based on your specific assay requirements.
IHC-P: 1:50-1:200
IF/ICC: 1:50-1:200
IP: 0.5ug-4ug antibody for 200ug-400ug extracts of whole cells
ELISA: Recommended starting concentration is 1ug/mL.
Please optimize the concentration based on your specific assay requirements.
Cross Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human S100A6(NP_055439.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
IP (Immunoprecipitation)
(Immunoprecipitation analysis of 200 ug extracts of U-251MG cells using 3 ug S100A6 antibody (AAA28618). Western blot was performed from the immunoprecipitate using S100A6 antibody (AAA28618) at a dilution of 1:1000.)
IP (Immunoprecipitation)
(Immunoprecipitation analysis of 200 ug extracts of U-251MG cells using 3 ug S100A6 antibody (AAA28618). Western blot was performed from the immunoprecipitate using S100A6 antibody (AAA28618) at a dilution of 1:1000.)
IF (Immunofluorescence)
(Immunofluorescence analysis of NIH/3T3 cells using S100A6 Rabbit pAb (AAA28618) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)
IF (Immunofluorescence)
(Immunofluorescence analysis of NIH/3T3 cells using S100A6 Rabbit pAb (AAA28618) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)
IF (Immunofluorescence)
(Immunofluorescence analysis of HeLa cells using S100A6 Rabbit pAb (AAA28618) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)
IF (Immunofluorescence)
(Immunofluorescence analysis of HeLa cells using S100A6 Rabbit pAb (AAA28618) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)
IHC (Immunohistochemistry)
(Immunohistochemistry analysis of paraffin-embedded Rat cerebellum using S100A6 Rabbit pAb (AAA28618) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)
IHC (Immunohistochemistry)
(Immunohistochemistry analysis of paraffin-embedded Rat cerebellum using S100A6 Rabbit pAb (AAA28618) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)
WB (Western Blot)
(Western blot analysis of various lysates using S100A6 Rabbit pAb (AAA28618) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates / proteins: 25 ug per lane. Blocking buffer: 3 % nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 1s.)
WB (Western Blot)
(Western blot analysis of various lysates using S100A6 Rabbit pAb (AAA28618) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates / proteins: 25 ug per lane. Blocking buffer: 3 % nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 1s.)
WB (Western Blot)
(Western blot analysis of lysates from U-251 MG cells using S100A6 Rabbit pAb (AAA28618) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3s.)
WB (Western Blot)
(Western blot analysis of lysates from U-251 MG cells using S100A6 Rabbit pAb (AAA28618) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3s.)
Related Product Information for anti-S100A6 antibody
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in stimulation of Ca2+-dependent insulin release, stimulation of prolactin secretion, and exocytosis. Chromosomal rearrangements and altered expression of this gene have been implicated in melanoma.
Product Categories/Family for anti-S100A6 antibody
NCBI and Uniprot Product Information
Similar Products
Product Notes
The S100A6 s100a6 (Catalog #AAA28618) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The S100A6 Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's S100A6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), Immunofluorescence (IF), Immunocytochemistry (ICC), Immunoprecipitation (IP), ELISA (EIA). WB: 1:500-1:1000 IHC-P: 1:50-1:200 IF/ICC: 1:50-1:200 IP: 0.5ug-4ug antibody for 200ug-400ug extracts of whole cells ELISA: Recommended starting concentration is 1ug/mL. Please optimize the concentration based on your specific assay requirements. Researchers should empirically determine the suitability of the S100A6 s100a6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MACPLDQAIG LLVAIFHKYS GREGDKHTLS KKELKELIQK ELTIGSKLQD AEIARLMEDL DRNKDQEVNF QEYVTFLGAL ALIYNEALKG. It is sometimes possible for the material contained within the vial of "S100A6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.