Rabbit SCD2 Polyclonal Antibody | anti-SCD2 antibody
SCD2 Antibody - N-terminal region
Gene Names
Scd2; swty; Scd-2; Mir5114; mir-5114
Reactivity
Mouse (Predicted Species Reactivity: Mouse)
Applications
Western Blot
Purity
Affinity purified
Synonyms
SCD2, Antibody; SCD2 Antibody - N-terminal region; anti-SCD2 antibody
Host
Rabbit
Reactivity
Mouse (Predicted Species Reactivity: Mouse)
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5mg/mL (varies by lot)
Sequence
Synthetic peptide located within the following region: SATTTITAPPSGGQQNGGEKFEKSSHHWGADVRPELKDDLYDPTYQDDEG
Sequence Length
358
Applicable Applications for anti-SCD2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of mouse SCD2
Protein Size (# AA)
358 amino acids
Blocking Peptide
For anti-SCD2 antibody
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-SCD2 antibody
Stearyl-CoA desaturase that utilizes O2Â and electrons from reduced cytochrome b5 to introduce the first double bond into saturated fatty acyl-CoA substrates. Catalyzes the insertion of a cis double bond at the delta-9 position into fatty acyl-CoA substrates including palmitoyl-CoA and stearoyl-CoA. Gives rise to a mixture of 16:1 and 18:1 unsaturated fatty acids. Contributes to the biosynthesis of membrane phospholipids, cholesterol esters and triglycerides, especially during embryonic development and in neonates. Important for normal permeability barrier function of the skin in neonate.
Product Categories/Family for anti-SCD2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39 kDa
NCBI Official Full Name
acyl-CoA desaturase 2
NCBI Official Synonym Full Names
stearoyl-Coenzyme A desaturase 2
NCBI Official Symbol
Scd2
NCBI Official Synonym Symbols
swty; Scd-2; Mir5114; mir-5114
NCBI Protein Information
acyl-CoA desaturase 2
UniProt Protein Name
Acyl-CoA desaturase 2
UniProt Gene Name
Scd2
UniProt Synonym Gene Names
Delta-9 desaturase 2
UniProt Entry Name
ACOD2_MOUSE
Similar Products
Product Notes
The SCD2 scd2 (Catalog #AAA23601) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SCD2 Antibody - N-terminal region reacts with Mouse (Predicted Species Reactivity: Mouse) and may cross-react with other species as described in the data sheet. AAA Biotech's SCD2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SCD2 scd2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SATTTITAPP SGGQQNGGEK FEKSSHHWGA DVRPELKDDL YDPTYQDDEG. It is sometimes possible for the material contained within the vial of "SCD2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.