Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA11644_IHC6.jpg IHC (Immunohistchemistry) (Anti- SFTP A1/2 Picoband antibody, AAA11644, IHC(F)IHC(F): Mouse Lung Tissue)

SFTPA1/2 Polyclonal Antibody | anti-SFTPA1/2 antibody

Anti-SFTPA1/2 Antibody

Gene Names
SFTPA2; PSAP; PSPA; SP-A; SPA2; PSP-A; SFTP1; SPAII; COLEC5; SFTPA2B
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Immunogen Affinity Purified
Synonyms
SFTPA1/2, Antibody; Anti-SFTPA1/2 Antibody; Pulmonary surfactant-associated protein A1/Pulmonary surfactant-associated protein A2; 35 kDa pulmonary surfactant associated protein; 35 kDa pulmonary surfactant-associated protein; Alveolar proteinosis protein; COLEC4; Collectin 4; Collectin-4; FLJ50593; FLJ51913; FLJ61144; FLJ77898,; FLJ79095; FLJ99559; MGC133365; MGC198590; OTTHUMP00000019928; OTTHUMP00000019929; OTTHUMP00000019930; OTTHUMP00000019931; PSAP; PSP A; PSP-A; PSPA; pulmonary surfactant -associated protein, 35-KD; pulmonary surfactant apoprotein PSP-A; pulmonary surfactant associated protein A1; Pulmonary surfactant-associated protein A1; SFTA1_HUMAN; SFTP1; SFTPA1; SFTPA1B; SP A; SP A1; SP-A; SP-A1; SPA; SPA1; surfactant protein A1; surfactant protein A1 variant AB'D' 6A2; surfactant protein A1 variant AB'D' 6A3; surfactant protein A1 variant AB'D' 6A4; surfactant protein A1 variant ACD' 6A2; surfactant protein A1 variant ACD' 6A3; surfactant protein A1 variant ACD' 6A4; surfactant protein A1 variant AD' 6A; surfactant protein A1 variant AD' 6A2; surfactant protein A1 variant AD' 6A3; surfactant protein A1 variant AD' 6A4; surfactant protein A1B; surfactant, pulmonary associated protein A1A; surfactant, pulmonary associated protein A1B; surfactant-associated protein, pulmonary 1; surfactant protein A1/surfactant protein A2; anti-SFTPA1/2 antibody
Ordering
For Research Use Only!
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
248
Applicable Applications for anti-SFTPA1/2 antibody
Western Blot (WB), Immunohistochemistry (IHC) Formalin/Paraffin
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
Immunohistochemistry (IHC) Formalin Concentration: 0.5-1ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human SFTPA1/2(206-237aa VNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRN), different from the related mouse sequence by four amino acids, and from the related rat sequence by five amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistchemistry)

(Anti- SFTP A1/2 Picoband antibody, AAA11644, IHC(F)IHC(F): Mouse Lung Tissue)

product-image-AAA11644_IHC6.jpg IHC (Immunohistchemistry) (Anti- SFTP A1/2 Picoband antibody, AAA11644, IHC(F)IHC(F): Mouse Lung Tissue)

IHC (Immunohistochemistry)

(Anti- SFTP A1/2 Picoband antibody, AAA11644, IHC(F)IHC(F): Rat Lung Tissue)

product-image-AAA11644_IHC5.jpg IHC (Immunohistochemistry) (Anti- SFTP A1/2 Picoband antibody, AAA11644, IHC(F)IHC(F): Rat Lung Tissue)

IHC (Immunohistochemistry)

(Anti- SFTP A1/2 Picoband antibody, AAA11644, IHC(P)IHC(P): Human Lung Cancer Tissue)

product-image-AAA11644_IHC4.jpg IHC (Immunohistochemistry) (Anti- SFTP A1/2 Picoband antibody, AAA11644, IHC(P)IHC(P): Human Lung Cancer Tissue)

IHC (Immunohistochemistry)

(Anti- SFTP A1/2 Picoband antibody, AAA11644, IHC(P)IHC(P): Rat Lung Tissue)

product-image-AAA11644_IHC3.jpg IHC (Immunohistochemistry) (Anti- SFTP A1/2 Picoband antibody, AAA11644, IHC(P)IHC(P): Rat Lung Tissue)

IHC (Immunohistochemistry)

(Anti- SFTP A1/2 Picoband antibody, AAA11644, IHC(P)IHC(P): Mouse Lung Tissue)

product-image-AAA11644_IHC2.jpg IHC (Immunohistochemistry) (Anti- SFTP A1/2 Picoband antibody, AAA11644, IHC(P)IHC(P): Mouse Lung Tissue)

WB (Western Blot)

(Anti- SFTP A1/2 Picoband antibody, AAA11644, Western blottingAll lanes: Anti SFTP (AAA11644) at 0.5ug/mlLane 1: Rat Lung Tissue Lysate at 50ugLane 2: Mouse Lung Tissue Lysate at 50ugLane 3: A549 Whole Cell Lysate at 40ugPredicted bind size: 26KDObserved bind size: 26KD)

product-image-AAA11644_WB.jpg WB (Western Blot) (Anti- SFTP A1/2 Picoband antibody, AAA11644, Western blottingAll lanes: Anti SFTP (AAA11644) at 0.5ug/mlLane 1: Rat Lung Tissue Lysate at 50ugLane 2: Mouse Lung Tissue Lysate at 50ugLane 3: A549 Whole Cell Lysate at 40ugPredicted bind size: 26KDObserved bind size: 26KD)
Related Product Information for anti-SFTPA1/2 antibody
Description: Rabbit IgG polyclonal antibody for Pulmonary surfactant-associated protein A1/Pulmonary surfactant-associated protein A2(SFTPA1/2) detection. Tested with WB, IHC-P, IHC-F in Human;Mouse;Rat.

Background: SFTPA1/2 is also known as SP-A. SFTPA1 encodes a lung surfactant protein that is a member of a subfamily of C-type lectins called collectins. The encoded protein binds specific carbohydrate moieties found on lipids and on the surface of microorganisms. This protein plays an essential role in surfactant homeostasis and in the defense against respiratory pathogens. Mutations in this gene are associated with idiopathic pulmonary fibrosis. Alternate splicing results in multiple transcript variants. SFTPA2 is one of several genes encoding pulmonary-surfactant associated proteins (SFTPA) located on chromosome 10. Mutations in this gene and a highly similar gene located nearby, which affect the highly conserved carbohydrate recognition domain, are associated with idiopathic pulmonary fibrosis. The current version of the assembly displays only a single centromeric SFTPA gene pair rather than the two gene pairs shown in the previous assembly which were thought to have resulted from a duplication.
References
1. Perez-Gil J, Weaver TE (June 2010). "Pulmonary surfactant pathophysiology: current models and open questions".Physiology (Bethesda) 25 (3): 132-41. 2. Phelps DS (2001). "Surfactant regulation of host defense function in the lung: a question of balance". Pediatr Pathol Mol Med 20 (4): 269-92.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
26,182 Da
NCBI Official Full Name
pulmonary surfactant-associated protein A2 isoform 1
NCBI Official Synonym Full Names
surfactant protein A2
NCBI Official Symbol
SFTPA2
NCBI Official Synonym Symbols
PSAP; PSPA; SP-A; SPA2; PSP-A; SFTP1; SPAII; COLEC5; SFTPA2B
NCBI Protein Information
pulmonary surfactant-associated protein A2
UniProt Protein Name
Pulmonary surfactant-associated protein A2
UniProt Gene Name
SFTPA2
UniProt Synonym Gene Names
COLEC5; PSAP; SFTP1; SFTPA; SFTPA2B; PSP-A; PSPA; SP-A; SP-A2
UniProt Entry Name
SFPA2_HUMAN

Similar Products

Product Notes

The SFTPA1/2 sftpa2 (Catalog #AAA11644) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-SFTPA1/2 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SFTPA1/2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC) Formalin/Paraffin. Western Blot Concentration: 0.1-0.5ug/ml Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml Immunohistochemistry (IHC) Formalin Concentration: 0.5-1ug/ml. Researchers should empirically determine the suitability of the SFTPA1/2 sftpa2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SFTPA1/2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.