Loading...

Skip to main content

Call us at +1-800-604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

IHC (Immunohistchemistry) (SLC4A4/NBC1 Antibody-Immunohistochemistry of paraffin-embedded rat lung using SLC4A4 antibody at dilution of 1:200 (400x lens).)

Rabbit SLC4A4/NBC1 Polyclonal Antibody | anti-SLC4A4 antibody

SLC4A4/NBC1 Rabbit anti-Human Polyclonal Antibody

Reactivity
Mouse, Rat, Human
Applications
Immunohistochemistry, Immunohistochemistry, Western Blot
Purity
Affinity purified
Synonyms
SLC4A4/NBC1, Antibody; SLC4A4/NBC1 Rabbit anti-Human Polyclonal Antibody; IHC-plus SLC4A4/NBC1 Antibody; SLC4A4; HhNMC; HNBC1; KNBC; KNBC1; Na+-HCO-3 cotransporter; NBC2; NBCE1; NBC1; PNBC1; Na(+)/HCO3(-) cotransporter; PNBC; HhNBC; NBC; anti-SLC4A4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse, Rat, Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Human SLC4A4/NBC1
Purity/Purification
Affinity purified
Form/Format
PBS, pH7.3, 0.02% Sodium Azide, 50% Glycerol
Applicable Applications for anti-SLC4A4 antibody
Immunohistochemistry (IHC), Immunohistochemistry-Paraffin (IHC-P), Western Blot (WB)
Application Notes
IHC: 1:50-1:200
IHC-P: 1:200
WB: 1:500-1:2000
The predicted MW is 72kDa/112kDa/116kDa/121kDa/123kDa, while the observed MW by Western blot was 135kDa.
Target
Human SLC4A4/NBC1
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human SLC4A4 (NP_003750.1). MSTENVEGKPSNLGERGRARSSTFLRVVQPMFNHSIFTSAVSPAAERIRFILGEEDDSPAPPQLFTELDELLAVDGQEMEWKETARWIKFEEKVEQGGERWSKPHVATLSLHSLFELRTCMEKGSIMLDREASSLPQLVEMIVDHQIETGLLKPELKDKVTYTLLRKHRHQTKKSNLRSLADIGKTVSSASRMFTNPDNGSPAMTHRNLTSSSLNDISDKPEKDQLKNKFMKKLPRDAEA
Conjugation
Unconjugated
Family
Transporter
Subfamily
Anion exchanger
Preparation and Storage
Store at -20 degree C. Avoid freeze-thaw cycles.

IHC (Immunohistchemistry)

(SLC4A4/NBC1 Antibody-Immunohistochemistry of paraffin-embedded rat lung using SLC4A4 antibody at dilution of 1:200 (400x lens).)

IHC (Immunohistchemistry) (SLC4A4/NBC1 Antibody-Immunohistochemistry of paraffin-embedded rat lung using SLC4A4 antibody at dilution of 1:200 (400x lens).)

IHC (Immunohistochemistry)

(SLC4A4/NBC1 Antibody-Immunohistochemistry of paraffin-embedded human lung cancer using SLC4A4 antibody at dilution of 1:200 (400x lens).)

IHC (Immunohistochemistry) (SLC4A4/NBC1 Antibody-Immunohistochemistry of paraffin-embedded human lung cancer using SLC4A4 antibody at dilution of 1:200 (400x lens).)

IHC (Immunohistochemistry)

(SLC4A4/NBC1 Antibody-Immunohistochemistry of paraffin-embedded human liver cancer using SLC4A4 antibody at dilution of 1:200 (400x lens).)

IHC (Immunohistochemistry) (SLC4A4/NBC1 Antibody-Immunohistochemistry of paraffin-embedded human liver cancer using SLC4A4 antibody at dilution of 1:200 (400x lens).)

IHC (Immunohistchemistry)

(SLC4A4/NBC1 Antibody-Immunohistochemistry of paraffin-embedded mouse kidney tissue.)

IHC (Immunohistchemistry) (SLC4A4/NBC1 Antibody-Immunohistochemistry of paraffin-embedded mouse kidney tissue.)

IHC (Immunohistochemistry)

(SLC4A4/NBC1 Antibody-Immunohistochemistry of paraffin-embedded rat kidney tissue.)

IHC (Immunohistochemistry) (SLC4A4/NBC1 Antibody-Immunohistochemistry of paraffin-embedded rat kidney tissue.)

IHC (Immunohistochemistry)

(SLC4A4/NBC1 Antibody-Immunohistochemistry of paraffin-embedded human prostate.)

IHC (Immunohistochemistry) (SLC4A4/NBC1 Antibody-Immunohistochemistry of paraffin-embedded human prostate.)

IHC (Immunohistochemistry)

(SLC4A4/NBC1 Antibody-Human Kidney: Formalin-Fixed, Paraffin-Embedded (FFPE))

IHC (Immunohistochemistry) (SLC4A4/NBC1 Antibody-Human Kidney: Formalin-Fixed, Paraffin-Embedded (FFPE))

IHC (Immunohistochemistry)

(SLC4A4/NBC1 Antibody-Human Pancreas: Formalin-Fixed, Paraffin-Embedded (FFPE))

IHC (Immunohistochemistry) (SLC4A4/NBC1 Antibody-Human Pancreas: Formalin-Fixed, Paraffin-Embedded (FFPE))

WB (Western Blot)

(SLC4A4/NBC1 Antibody-Western blot analysis of extracts of various cell lines, using SLC4A4 antibody.)

WB (Western Blot) (SLC4A4/NBC1 Antibody-Western blot analysis of extracts of various cell lines, using SLC4A4 antibody.)
Related Product Information for anti-SLC4A4 antibody
NBC1 antibody is an unconjugated rabbit polyclonal antibody to NBC1 (SLC4A4) from human. It is reactive with human, mouse and rat. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.

NCBI and Uniprot Product Information

NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
UniProt Protein Name
Electrogenic sodium bicarbonate cotransporter 1
UniProt Gene Name
SLC4A4
UniProt Synonym Gene Names
NBC; NBC1; NBCE1; Sodium bicarbonate cotransporter
UniProt Entry Name
S4A4_HUMAN

Similar Products

Product Notes

The SLC4A4 slc4a4 (Catalog #AAA21317) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC4A4/NBC1 Rabbit anti-Human Polyclonal Antibody reacts with Mouse, Rat, Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC4A4/NBC1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Immunohistochemistry-Paraffin (IHC-P), Western Blot (WB). IHC: 1:50-1:200 IHC-P: 1:200 WB: 1:500-1:2000 The predicted MW is 72kDa/112kDa/116kDa/121kDa/123kDa, while the observed MW by Western blot was 135kDa. Researchers should empirically determine the suitability of the SLC4A4 slc4a4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC4A4/NBC1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.