Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23478_WB6.jpg WB (Western Blot) (WB Suggested Anti-SSB Antibody Titration: 0.25 ug/mlPositive Control: Jurkat cell lysateSSB is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Rabbit SSB Polyclonal Antibody | anti-SSB antibody

SSB antibody - N-terminal region

Gene Names
SSB; La; LARP3; La/SSB
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
SSB, Antibody; SSB antibody - N-terminal region; anti-SSB antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWL
Sequence Length
408
Applicable Applications for anti-SSB antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SSB
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SSB Antibody Titration: 0.25 ug/mlPositive Control: Jurkat cell lysateSSB is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

product-image-AAA23478_WB6.jpg WB (Western Blot) (WB Suggested Anti-SSB Antibody Titration: 0.25 ug/mlPositive Control: Jurkat cell lysateSSB is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

WB (Western Blot)

(Host: RabbitTarget Name: SSBSample Type: JurkatLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 2.0ug/mLPeptide Concentration: 2.0ug/mLLysate Quantity: 25ug/laneGel Concentration: 12%)

product-image-AAA23478_WB5.jpg WB (Western Blot) (Host: RabbitTarget Name: SSBSample Type: JurkatLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 2.0ug/mLPeptide Concentration: 2.0ug/mLLysate Quantity: 25ug/laneGel Concentration: 12%)

IHC (Immunohistochemistry)

(Rabbit Anti-SSB AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA23478_IHC4.jpg IHC (Immunohistochemistry) (Rabbit Anti-SSB AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IHC (Immunohistochemistry)

(Rabbit Anti-SSB AntibodyParaffin Embedded Tissue: Human cardiac cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA23478_IHC3.jpg IHC (Immunohistochemistry) (Rabbit Anti-SSB AntibodyParaffin Embedded Tissue: Human cardiac cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IHC (Immunohistochemistry)

(nti-SSB antibody IHC staining of human liver. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)

product-image-AAA23478_IHC2.jpg IHC (Immunohistochemistry) (nti-SSB antibody IHC staining of human liver. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)

IHC (Immunohistochemistry)

(Immunohistochemistry with Human Prostate lysate tissue at an antibody concentration of 5.0ug/ml using anti-SSB antibody)

product-image-AAA23478_IHC.jpg IHC (Immunohistochemistry) (Immunohistochemistry with Human Prostate lysate tissue at an antibody concentration of 5.0ug/ml using anti-SSB antibody)
Related Product Information for anti-SSB antibody
This is a rabbit polyclonal antibody against SSB. It was validated on Western Blot and immunohistochemistry

Target Description: SSB is involved in diverse aspects of RNA metabolism, including binding and protecting 3-prime UUU(OH) elements of newly RNA polymerase III-transcribed RNA, processing 5-prime and 3-prime ends of pre-tRNA precursors, acting as an RNA chaperone, and binding viral RNAs associated with hepatitis C virus. SSB protein was originally defined by its reactivity with autoantibodies from patients with Sjogren syndrome and systemic lupus erythematosus.La is involved in diverse aspects of RNA metabolism, including binding and protecting 3-prime UUU(OH) elements of newly RNA polymerase III (see MIM 606007)-transcribed RNA, processing 5-prime and 3-prime ends of pre-tRNA precursors, acting as an RNA chaperone, and binding viral RNAs associated with hepatitis C virus. La protein was originally defined by its reactivity with autoantibodies from patients with Sjogren syndrome (MIM 270150) and systemic lupus erythematosus (SLE; MIM 152700) (Teplova et al., 2006).[supplied by OMIM].

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
lupus La protein
NCBI Official Synonym Full Names
small RNA binding exonuclease protection factor La
NCBI Official Symbol
SSB
NCBI Official Synonym Symbols
La; LARP3; La/SSB
NCBI Protein Information
lupus La protein
UniProt Protein Name
Lupus La protein
UniProt Gene Name
SSB
UniProt Synonym Gene Names
SS-B
UniProt Entry Name
LA_HUMAN

Similar Products

Product Notes

The SSB ssb (Catalog #AAA23478) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SSB antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SSB can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the SSB ssb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ISEDKTKIRR SPSKPLPEVT DEYKNDVKNR SVYIKGFPTD ATLDDIKEWL. It is sometimes possible for the material contained within the vial of "SSB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.