PRAME recombinant protein
Human PRAME
Gene Names
PRAME; MAPE; OIP4; CT130; OIP-4
Reactivity
Human
Applications
Western Blot, ELISA
Purity
> 98% by SDS-PAGE & silver stain
Synonyms
PRAME; N/A; Human PRAME; Recombinant Human PRAME (C-terminal fragment); Melanoma antigen preferentially expressed in tumors; Opa-interacting protein 4; MAPE; OIP4; PRAME recombinant protein
Host
E Coli
Reactivity
Human
Purity/Purification
> 98% by SDS-PAGE & silver stain
Form/Format
Lyophilized
Sequence
MNPLETLSITNCRLSEGDVMHLSQSPSVSQLSVLSLSGVMLTDVSPEPLQ ALLERASATLQDLVFDECGITDDQLLALLPSLSHCSQLTTLSFYGNSISI
Sequence Length
100
Applicable Applications for PRAME recombinant protein
Western Blot (WB), ELISA
Application Notes
1. Positive control for Western blot analysis
2. Standard for ELISA.
2. Standard for ELISA.
Stabilizer
none
Buffer
10mM Tris, 25 mM NaP, pH 7.4
Length (aa)
100
Preparation and Storage
Stability: The lyophilized human PRAME, though stable at room temperature, is best stored desiccated below 0°C. Reconstituted human PRAME should be stored in working aliquots at -20°C.
Reconstitution: Human PRAME should be reconstituted in water to a concentration of 0.1 mg/ml. This solution can be diluted in water or other buffer solutions or stored at -20°C.
Reconstitution: Human PRAME should be reconstituted in water to a concentration of 0.1 mg/ml. This solution can be diluted in water or other buffer solutions or stored at -20°C.
Related Product Information for PRAME recombinant protein
PRAME/MAPE/OIP4 is a germinal tissue-specific gene that is also expressed at high levels in haematological malignancies and solid tumors. The physiological functions of PRAME in normal and tumor cells are unknown, although a role in the regulation of retinoic acid signaling has been proposed. Sequence homology and structural predictions suggest that PRAME is related to the Leucine-rich repeat (LRR) family of proteins, which have diverse functions. PRAME, or „preferentially expressed antigen in melanoma”, was originally identified as a gene encoding a HLA-A24 restricted antigenic peptide presented to autologous tumor-specific cytotoxic T lymphocytes derived from a patient with melanoma. PRAME is synonymous with MAPE (melanoma antigen preferentially expressed in tumors) and OIP4 (OPA-interacting protein 4), and its expression profile defines it as a cancer-testis antigen. Cancer-testis antigens (CTAs) are encoded by non-mutated genes expressed at high levels in germinal tissues and tumors, but which are absent from or detected at low levels in other tissues. PRAME may be somewhat different to other cancer-testis antigens in that it shows some expression in normal tissues such as ovary, adrenal, placenta and endometrium. The C-terminus of human PRAME (amino acids 453-509) was also identified to bind Neisseria gonorrhoeae opacity factors, in this case the OPA-P protein. Thus PRAME is also known as OIP4 (OPA interacting protein), although the functional implications of the interaction are unknown. Recombinant human PRAME fragment corresponds to amino acid sequence Met321 to Ile420.
Product Categories/Family for PRAME recombinant protein
References
1. Ikeda H et al, Immunity 1997, 6:199-208 2. Haqq C et al, Proc Natl Acad Sci USA 2005, 102:6092 3. Williams JM et al, Mol Microbiol 1998, 27:171-186 4. Nakamura Y et al, Ann Surg Oncol 2007, 14:885-892
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
10.7 kDa
NCBI Official Full Name
melanoma antigen preferentially expressed in tumors
NCBI Official Synonym Full Names
preferentially expressed antigen in melanoma
NCBI Official Symbol
PRAME
NCBI Official Synonym Symbols
MAPE; OIP4; CT130; OIP-4
NCBI Protein Information
melanoma antigen preferentially expressed in tumors; cancer/testis antigen 130; opa-interacting protein 4; Opa-interacting protein OIP4; preferentially expressed antigen of melanoma
UniProt Protein Name
Melanoma antigen preferentially expressed in tumors
UniProt Gene Name
PRAME
UniProt Synonym Gene Names
MAPE; OIP4; OIP-4
UniProt Entry Name
PRAME_HUMAN
Similar Products
Product Notes
The PRAME prame (Catalog #AAA14950) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The Human PRAME reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PRAME can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), ELISA. 1. Positive control for Western blot analysis 2. Standard for ELISA. Researchers should empirically determine the suitability of the PRAME prame for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MNPLETLSIT NCRLSEGDVM HLSQSPSVSQ LSVLSLSGVM LTDVSPEPLQ ALLERASATL QDLVFDECGI TDDQLLALLP SLSHCSQLTT LSFYGNSISI. It is sometimes possible for the material contained within the vial of "PRAME, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.