Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Ras-related protein Rab-1A (RAB1A) Recombinant Protein | RAB1A recombinant protein

Recombinant Human Ras-related protein Rab-1A (RAB1A)

Average rating 0.0
No ratings yet
Gene Names
RAB1A; RAB1; YPT1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Ras-related protein Rab-1A (RAB1A); N/A; Recombinant Human Ras-related protein Rab-1A (RAB1A); RAB1A recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-205aa; Full Length of Mature Protein
Sequence
SSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGCC
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for RAB1A recombinant protein
This gene encodes a member of the Ras superfamily of GTPases. Members of the gene family cycle between inactive GDP-bound and active GTP-bound forms. This small GTPase controls vesicle traffic from the endoplasmic reticulum to the Golgi apparatus. Multiple alternatively spliced transcript variants have been identified for this gene which encode different protein isoforms.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13,903 Da
NCBI Official Full Name
ras-related protein Rab-1A isoform 1
NCBI Official Synonym Full Names
RAB1A, member RAS oncogene family
NCBI Official Symbol
RAB1A
NCBI Official Synonym Symbols
RAB1; YPT1
NCBI Protein Information
ras-related protein Rab-1A
UniProt Protein Name
Ras-related protein Rab-1A
UniProt Gene Name
RAB1A
UniProt Synonym Gene Names
RAB1

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The RAB1A rab1a (Catalog #AAA113977) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-205aa; Full Length of Mature Protein. The amino acid sequence is listed below: SSMNPEYDYL FKLLLIGDSG VGKSCLLLRF ADDTYTESYI STIGVDFKIR TIELDGKTIK LQIWDTAGQE RFRTITSSYY RGAHGIIVVY DVTDQESFNN VKQWLQEIDR YASENVNKLL VGNKCDLTTK KVVDYTTAKE FADSLGIPFL ETSAKNATNV EQSFMTMAAE IKKRMGPGAT AGGAEKSNVK IQSTPVKQSG GGCC. It is sometimes possible for the material contained within the vial of "Ras-related protein Rab-1A (RAB1A), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.