Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Secretogranin-3 (Scg3) Recombinant Protein | Scg3 recombinant protein

Recombinant Rat Secretogranin-3 (Scg3)

Average rating 0.0
No ratings yet
Gene Names
Scg3; SgIII
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Secretogranin-3 (Scg3); N/A; Recombinant Rat Secretogranin-3 (Scg3); Scg3 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
23-471. Full Length of Mature Protein
Sequence
FPKPEGSQDKSLHNRELSAERPLNEQIAEAEADKIKKTYPSESKPSESNFSSVDNLNLLKAITEKETVEKAKQSIRSSPFDNRLNVDDADSTKNRKLTDEYDSTKSGLDRKVQDDPDGLHQLDGTPLTAEDIVHKIATRIYEENDRGVFDKIVSKLLNLGLITESQAHTLEDEVAEALQKLISKEANNYEEAPEKPTSRTENQDGKIPEKVTPVAATQDGFTNRENDDTVSNTLTLSNGLERRTNPHRDDDFEELQYFPNFYALLTSIDSEKEAKEKETLITIMKTLIDFVKMMVKYGTISPEEGVSYLENLDETIALQTKNKLEKNTTDSKSKLFPAPPEKSHEETDSTKEEAAKMEKEYGSLKDSTKDDNSNLGGKTDEAKGKTEAYLEAIRKNIEWLKKHNKKGNKEDYDLSKMRDFINQQADAYVEKGILDKEEANAIKRIYSSL
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Scg3 recombinant protein
This protein is a member of the chromogranin
secretogranin family of neuroendocrine secretory proteins. Granins may serve as precursors for biologically active peptides. Some granins have been shown to function as helper proteins in sorting and proteolytic processing of prohormones; however, the function of this protein is unknown. Two transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53,183 Da
NCBI Official Full Name
secretogranin-3
NCBI Official Synonym Full Names
secretogranin III
NCBI Official Symbol
Scg3
NCBI Official Synonym Symbols
SgIII
NCBI Protein Information
secretogranin-3
UniProt Protein Name
Secretogranin-3
UniProt Gene Name
Scg3
UniProt Synonym Gene Names
SgIII

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The Scg3 scg3 (Catalog #AAA113169) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-471. Full Length of Mature Protein. The amino acid sequence is listed below: FPKPEGSQDK SLHNRELSAE RPLNEQIAEA EADKIKKTYP SESKPSESNF SSVDNLNLLK AITEKETVEK AKQSIRSSPF DNRLNVDDAD STKNRKLTDE YDSTKSGLDR KVQDDPDGLH QLDGTPLTAE DIVHKIATRI YEENDRGVFD KIVSKLLNLG LITESQAHTL EDEVAEALQK LISKEANNYE EAPEKPTSRT ENQDGKIPEK VTPVAATQDG FTNRENDDTV SNTLTLSNGL ERRTNPHRDD DFEELQYFPN FYALLTSIDS EKEAKEKETL ITIMKTLIDF VKMMVKYGTI SPEEGVSYLE NLDETIALQT KNKLEKNTTD SKSKLFPAPP EKSHEETDST KEEAAKMEKE YGSLKDSTKD DNSNLGGKTD EAKGKTEAYL EAIRKNIEWL KKHNKKGNKE DYDLSKMRDF INQQADAYVE KGILDKEEAN AIKRIYSSL. It is sometimes possible for the material contained within the vial of "Secretogranin-3 (Scg3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.