SDS-PAGE
Tissue factor pathway inhibitor (TFPI) Recombinant Protein | TFPI recombinant protein
Recombinant Rabbit Tissue factor pathway inhibitor (TFPI)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Tissue factor pathway inhibitor (TFPI); N/A; Recombinant Rabbit Tissue factor pathway inhibitor (TFPI); Extrinsic pathway inhibitor; EPI; Lipoprotein-associated coagulation inhibitor; LACI; TFPI recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
25-300aa; Full Length of Mature Protein
Sequence
AAEEDEEFTNITDIKPPLQKPTHSFCAMKVDDGPCRAYIKRFFFNILTHQCEEFIYGGCEGNENRFESLEECKEKCARDYPKMTTKLTFQKGKPDFCFLEEDPGICRGYITRYFYNNQSKQCERFKYGGCLGNLNNFESLEECKNTCENPTSDFQVDDHRTQLNTVNNTLINQPTKAPRRWAFHGPSWCLPPADRGLCQANEIRFFYNAIIGKCRPFKYSGCGGNENNFTSKKACITACKKGFIPKSIKGGLIKTKRKKKKQPVKITYVETFVKKT
Production Note
Special Offer: The Baculovirus, E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. Baculovirus, E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The Baculovirus, E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select Baculovirus, E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our or email to for more details.
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for TFPI recombinant protein
Inhibits factor X (X(a)) directly and, in a Xa-dependent way, inhibits VIIa/tissue factor activity, presumably by forming a quaternary Xa/LACI/VIIa/TF complex. It possesses an antithrombotic action and also the ability to associate with lipoproteins in plasma.
References
cDNA sequence of rabbit lipoprotein-associated coagulation inhibitor.Wesselschmidt R.L., Girard T.J., Broze G.J. Jr.Nucleic Acids Res. 18:6440-6440(1990) cDNA sequence of rabbit tissue factor pathway inhibitor.Warn-Cramer B.J., Broze G.J. Jr., Komives E.A.Nucleic Acids Res. 20:3548-3548(1992) Revised cDNA sequence of rabbit tissue factor pathway inhibitor.Belaaouaj A., Kuppuswamy M.N., Birktoft J.J., Bajaj S.P.Thromb. Res. 69:547-553(1993)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
33.8 kDa
NCBI Official Full Name
tissue factor pathway inhibitor
UniProt Protein Name
Tissue factor pathway inhibitor
UniProt Gene Name
TFPI
UniProt Synonym Gene Names
TFPI; EPI; LACI
UniProt Entry Name
TFPI1_RABIT
Similar Products
Product Notes
The TFPI tfpi (Catalog #AAA113567) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 25-300aa; Full Length of Mature Protein. The amino acid sequence is listed below: AAEEDEEFTN ITDIKPPLQK PTHSFCAMKV DDGPCRAYIK RFFFNILTHQ CEEFIYGGCE GNENRFESLE ECKEKCARDY PKMTTKLTFQ KGKPDFCFLE EDPGICRGYI TRYFYNNQSK QCERFKYGGC LGNLNNFESL EECKNTCENP TSDFQVDDHR TQLNTVNNTL INQPTKAPRR WAFHGPSWCL PPADRGLCQA NEIRFFYNAI IGKCRPFKYS GCGGNENNFT SKKACITACK KGFIPKSIKG GLIKTKRKKK KQPVKITYVE TFVKKT. It is sometimes possible for the material contained within the vial of "Tissue factor pathway inhibitor (TFPI), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.