Beta-lactamase (NDM-1) Recombinant Protein | NDM-1 recombinant protein
Recombinant Acinetobacter baumannii Beta-lactamase (NDM-1), partial
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Beta-lactamase (NDM-1); N/A; Recombinant Acinetobacter baumannii Beta-lactamase (NDM-1), partial; NDM-1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
164-222aa; Partial
Sequence
AANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLG
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
References
Molecular characterization of blaNDM-1 in an Acinetobacter baumannii strain isolated in Germany in 2007.Pfeifer Y., Wilharm G., Zander E., Wichelhaus T.A., Gottig S., Hunfeld K.P., Seifert H., Witte W., Higgins P.G.J. Antimicrob. Chemother. 66:1998-2001(2011)
Characterization of a new metallo-beta-lactamase 1 gene (blaNDM-1)
among clinical strains from Vietnam.Cao V., Hoang N.K.Q., Le H.T.D., Le T.L. Tn125-Related Acquisition of blaNDM-Like Genes in Acinetobacter baumannii.Poirel L., Bonnin R.A., Boulanger A., Schrenzel J., Kaase M., Nordmann P.Antimicrob. Agents Chemother. 56:1087-1089(2012)
Dissemination of New Delhi metallo-?-lactamase-1-producing Acinetobacter baumannii in Europe.Bonnin R.A., Poirel L., Naas T., Pirs M., Seme K., Schrenzel J., Nordmann P.Clin. Microbiol. Infect. 18:E362-E365(2012)
Molecular characteristics and epidemiology of a novel sequence type 435 Acinetobacter baumannii harbored blaNDM-1, blaIMP-1, blaOXA-23-like, tetA and tetB in China.Cao J., Liu J., Wu Q., Shu H., Zhang X., Li X., Bao Q., Zhou T. Molecular characteristics and Epidemiology of Novel Sequence Type 435 Acinetobacter baumannii harbored blaNDM-1, blaIMP-1, blaOXA-23-like, tetA and tetB in China.Cao J., Liu J., Wu Q., Shu H., Zhang X., Li X., Bao Q., Zhou T. Complete sequence of the blaNDM-1-carrying plasmid pNDM-AB from Acinetobacter baumannii of food animal origin.Zhang W.J., Lu Z., Schwarz S., Zhang R.M., Wang X.M., Si W., Yu S., Chen L., Liu S.J. Antimicrob. Chemother. 68:1681-1682(2013)
blaNDM-1 context 1 from Acinetobacter baumannii CHI-45-1.Jones L.S., Toleman M.A., Weeks J.L., Kumarasamy K.K., Howe R.A., Walsh T.R. blaNDM-1 context 2 from Acinetobacter baumannii CHI-45-1.Jones L.S., Toleman M.A., Weeks J.L., Kumarasamy K.K., Howe R.A., Walsh T.R. Drug resistance of aerobic bacteria from puerperal infections in Bangladesh.Kobayashi N., Kawaguchiya M., Ahmed S. Complete genome sequence of Acinetobacter baumannii IOMTU433.Tada T., Shrestha S., Miyoshi-Akiyama T., Shimada K., Kirikae T. NDM-1-Producing Citrobacter freundii, Escherichia coli and Acinetobacter baumannii Identified from a Single Patient in China.Tian G.-B.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22 kDa
NCBI Official Full Name
MULTISPECIES: subclass B1 metallo-beta-lactamase NDM-1
NCBI Official Symbol
blaNDM-1
NCBI Protein Information
New Delhi metallo-beta-lactamse 1
UniProt Protein Name
Beta-lactamase
UniProt Gene Name
NDM-1
UniProt Entry Name
F8UNN7_ACIBA
