Beta-lactamase (NDM-1) Recombinant Protein | NDM-1 recombinant protein
Recombinant Acinetobacter baumannii Beta-lactamase (NDM-1), partial
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Beta-lactamase (NDM-1); N/A; Recombinant Acinetobacter baumannii Beta-lactamase (NDM-1), partial; NDM-1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
164-222aa; Partial
Sequence
AANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLG
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
References
Molecular characterization of blaNDM-1 in an Acinetobacter baumannii strain isolated in Germany in 2007.Pfeifer Y., Wilharm G., Zander E., Wichelhaus T.A., Gottig S., Hunfeld K.P., Seifert H., Witte W., Higgins P.G.J. Antimicrob. Chemother. 66:1998-2001(2011)
Characterization of a new metallo-beta-lactamase 1 gene (blaNDM-1)
among clinical strains from Vietnam.Cao V., Hoang N.K.Q., Le H.T.D., Le T.L. Tn125-Related Acquisition of blaNDM-Like Genes in Acinetobacter baumannii.Poirel L., Bonnin R.A., Boulanger A., Schrenzel J., Kaase M., Nordmann P.Antimicrob. Agents Chemother. 56:1087-1089(2012)
Dissemination of New Delhi metallo-?-lactamase-1-producing Acinetobacter baumannii in Europe.Bonnin R.A., Poirel L., Naas T., Pirs M., Seme K., Schrenzel J., Nordmann P.Clin. Microbiol. Infect. 18:E362-E365(2012)
Molecular characteristics and epidemiology of a novel sequence type 435 Acinetobacter baumannii harbored blaNDM-1, blaIMP-1, blaOXA-23-like, tetA and tetB in China.Cao J., Liu J., Wu Q., Shu H., Zhang X., Li X., Bao Q., Zhou T. Molecular characteristics and Epidemiology of Novel Sequence Type 435 Acinetobacter baumannii harbored blaNDM-1, blaIMP-1, blaOXA-23-like, tetA and tetB in China.Cao J., Liu J., Wu Q., Shu H., Zhang X., Li X., Bao Q., Zhou T. Complete sequence of the blaNDM-1-carrying plasmid pNDM-AB from Acinetobacter baumannii of food animal origin.Zhang W.J., Lu Z., Schwarz S., Zhang R.M., Wang X.M., Si W., Yu S., Chen L., Liu S.J. Antimicrob. Chemother. 68:1681-1682(2013)
blaNDM-1 context 1 from Acinetobacter baumannii CHI-45-1.Jones L.S., Toleman M.A., Weeks J.L., Kumarasamy K.K., Howe R.A., Walsh T.R. blaNDM-1 context 2 from Acinetobacter baumannii CHI-45-1.Jones L.S., Toleman M.A., Weeks J.L., Kumarasamy K.K., Howe R.A., Walsh T.R. Drug resistance of aerobic bacteria from puerperal infections in Bangladesh.Kobayashi N., Kawaguchiya M., Ahmed S. Complete genome sequence of Acinetobacter baumannii IOMTU433.Tada T., Shrestha S., Miyoshi-Akiyama T., Shimada K., Kirikae T. NDM-1-Producing Citrobacter freundii, Escherichia coli and Acinetobacter baumannii Identified from a Single Patient in China.Tian G.-B.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22 kDa
NCBI Official Full Name
MULTISPECIES: subclass B1 metallo-beta-lactamase NDM-1
NCBI Official Symbol
blaNDM-1
NCBI Protein Information
New Delhi metallo-beta-lactamse 1
UniProt Protein Name
Beta-lactamase
UniProt Gene Name
NDM-1
UniProt Entry Name
F8UNN7_ACIBA
Similar Products
Product Notes
The NDM-1 ndm-1 (Catalog #AAA15920) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 164-222aa; Partial. The amino acid sequence is listed below: AANGWVEPAT APNFGPLKVF YPGPGHTSDN ITVGIDGTDI AFGGCLIKDS KAKSLGNLG. It is sometimes possible for the material contained within the vial of "Beta-lactamase (NDM-1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.