Complement C1q subcomponent subunit A (C1qa) Recombinant Protein | C1qa recombinant protein
Recombinant Mouse Complement C1q subcomponent subunit A (C1qa)
Gene Names
C1qa; C1q; AI255395
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Complement C1q subcomponent subunit A (C1qa); N/A; Recombinant Mouse Complement C1q subcomponent subunit A (C1qa); C1qa recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
23-245aa; Full Length of Mature Protein
Sequence
EDVCRAPNGKDGAPGNPGRPGRPGLKGERGEPGAAGIRTGIRGFKGDPGESGPPGKPGNVGLPGPSGPLGDSGPQGLKGVKGNPGNIRDQPRPAFSAIRQNPMTLGNVVIFDKVLTNQESPYQNHTGRFICAVPGFYYFNFQVISKWDLCLFIKSSSGGQPRDSLSFSNTNNKGLFQVLAGGTVLQLRRGDEVWIEKDPAKGRIYQGTEADSIFSGFLIFPSA
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for C1qa recombinant protein
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complent system. The collagen-like regions of C1q interact with the Ca2+-dependent C1r2C1s2 proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
References
Gene expression of the A- and B-chain of mouse C1q in different tissues and the characterization of the recombinant A-chain.Petry F., Reid K.B.M., Loos M.J. Immunol. 147:3988-3993(1991)
The mouse C1q genes are clustered on chromosome 4 and show conservation of gene organization.Petry F., McClive P.J., Botto M., Morley B.J., Morahan G., Loos M.Immunogenetics 43:370-376(1996)
Lineage-specific biology revealed by a finished genome assembly of the mouse.Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S., Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009)
Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.
Proteome-wide characterization of N-glycosylation events by diagonal chromatography.Ghesquiere B., Van Damme J., Martens L., Vandekerckhove J., Gevaert K.J. Proteome Res. 5:2438-2447(2006)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
25.6 kDa
NCBI Official Full Name
complement C1q subcomponent subunit A
NCBI Official Synonym Full Names
complement component 1, q subcomponent, alpha polypeptide
NCBI Official Symbol
C1qa
NCBI Official Synonym Symbols
C1q; AI255395
NCBI Protein Information
complement C1q subcomponent subunit A
UniProt Protein Name
Complement C1q subcomponent subunit A
UniProt Gene Name
C1qa
UniProt Entry Name
C1QA_MOUSE