Carcinoembryonic antigen-related cell adhesion molecule 4 (CEACAM4) Recombinant Protein | CEACAM4 recombinant protein

Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 4 (CEACAM4), partial

Cat. Num. AAA18606

• Gene Names: CEACAM4; NCA; CGM7; CGM7_HUMAN
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Carcinoembryonic antigen-related cell adhesion molecule 4 (CEACAM4); N/A; Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 4 (CEACAM4), partial; Carcinoembryonic antigen CGM7; Non-specific cross-reacting antigen W236; CEACAM4 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 36-155aa; Extracellular Domain
• Sequence: FTIEALPSSAAEGKDVLLLACNISETIQAYYWHKGKTAEGSPLIAGYITDIQANIPGAAYSGRETVYPNGSLLFQNITLEDAGSYTLRTINASYDSDQATGQLHVHQNNVPGLPVGAVAG

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for CEACAM4 recombinant protein

Granulocyte orphan receptor that acts as an trigger efficient phagocytosis of attached particles.

Product Categories/Family for CEACAM4 recombinant protein

Immunology

References

Molecular cloning of nonspecific cross-reacting antigens in human granulocytes.Kuroki M., Arakawa F., Matsuo Y., Oikawa S., Misumi Y., Nakazato H., Matsuoka Y.J. Biol. Chem. 266:11810-11817(1991) The DNA sequence and biology of human chromosome 19.Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V., Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.Nature 428:529-535(2004)

NCBI and Uniprot Product Information

• NCBI GI #: 71143132
• NCBI GeneID: 1089
• NCBI Accession #: NP_001808.2
• NCBI GenBank Nucleotide #: NM_001817.3
• UniProt Accession #: O75871; Q03715; Q7LDZ7
• Molecular Weight: 14.7 kDa
• NCBI Official Full Name: carcinoembryonic antigen-related cell adhesion molecule 4
• NCBI Official Synonym Full Names: carcinoembryonic antigen related cell adhesion molecule 4
• NCBI Official Symbol: CEACAM4
• NCBI Official Synonym Symbols: NCA; CGM7; CGM7_HUMAN
• NCBI Protein Information: carcinoembryonic antigen-related cell adhesion molecule 4
• UniProt Protein Name: Carcinoembryonic antigen-related cell adhesion molecule 4
• UniProt Gene Name: CEACAM4
• UniProt Synonym Gene Names: CGM7
• UniProt Entry Name: CEAM4_HUMAN