Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA18606_SDS_PAGE.jpg SDS-PAGE

Carcinoembryonic antigen-related cell adhesion molecule 4 (CEACAM4) Recombinant Protein | CEACAM4 recombinant protein

Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 4 (CEACAM4), partial

Average rating 0.0
No ratings yet
Gene Names
CEACAM4; NCA; CGM7; CGM7_HUMAN
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Carcinoembryonic antigen-related cell adhesion molecule 4 (CEACAM4); N/A; Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 4 (CEACAM4), partial; Carcinoembryonic antigen CGM7; Non-specific cross-reacting antigen W236; CEACAM4 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
36-155aa; Extracellular Domain
Sequence
FTIEALPSSAAEGKDVLLLACNISETIQAYYWHKGKTAEGSPLIAGYITDIQANIPGAAYSGRETVYPNGSLLFQNITLEDAGSYTLRTINASYDSDQATGQLHVHQNNVPGLPVGAVAG
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA18606_SDS_PAGE.jpg SDS-PAGE
Related Product Information for CEACAM4 recombinant protein
Granulocyte orphan receptor that acts as an trigger efficient phagocytosis of attached particles.
Product Categories/Family for CEACAM4 recombinant protein
References
Molecular cloning of nonspecific cross-reacting antigens in human granulocytes.Kuroki M., Arakawa F., Matsuo Y., Oikawa S., Misumi Y., Nakazato H., Matsuoka Y.J. Biol. Chem. 266:11810-11817(1991) The DNA sequence and biology of human chromosome 19.Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V., Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.Nature 428:529-535(2004)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14.7 kDa
NCBI Official Full Name
carcinoembryonic antigen-related cell adhesion molecule 4
NCBI Official Synonym Full Names
carcinoembryonic antigen related cell adhesion molecule 4
NCBI Official Symbol
CEACAM4
NCBI Official Synonym Symbols
NCA; CGM7; CGM7_HUMAN
NCBI Protein Information
carcinoembryonic antigen-related cell adhesion molecule 4
UniProt Protein Name
Carcinoembryonic antigen-related cell adhesion molecule 4
UniProt Gene Name
CEACAM4
UniProt Synonym Gene Names
CGM7
UniProt Entry Name
CEAM4_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CEACAM4 ceacam4 (Catalog #AAA18606) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 36-155aa; Extracellular Domain. The amino acid sequence is listed below: FTIEALPSSA AEGKDVLLLA CNISETIQAY YWHKGKTAEG SPLIAGYITD IQANIPGAAY SGRETVYPNG SLLFQNITLE DAGSYTLRTI NASYDSDQAT GQLHVHQNNV PGLPVGAVAG . It is sometimes possible for the material contained within the vial of "Carcinoembryonic antigen-related cell adhesion molecule 4 (CEACAM4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.