Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

Isoleucine--tRNA ligase, cytoplasmic (Iars) Recombinant Protein | Iars recombinant protein

Recombinant Mouse Isoleucine--tRNA ligase, cytoplasmic (Iars) , partial

Gene Names
Iars; ILRS; AI327140; AU044614; 2510016L12Rik; E430001P04Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Isoleucine--tRNA ligase; cytoplasmic (Iars); Recombinant Mouse Isoleucine--tRNA ligase; partial; Iars recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
732-831aa; Partial
Sequence
NWYVRMNRRRLKGESGVEDCVMALETLFSVLLSLCRLMAPYTPFLTELMYQNLKLLIDPASLRDKDTLSIHYLMLPRVREELIDKKTENAVSRMQSVIEL
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Iars recombinant protein
Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAS, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Isoleucine-tRNA synthetase belongs to the class-I aminoacyl-tRNA synthetase family and has been identified as a target of autoantibodies in the autoimmune disease polymyositis
dermatomyositis. Two alternatively spliced variants have been isolated that represent alternate 5 UTRs.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
144,271 Da
NCBI Official Full Name
isoleucine--tRNA ligase, cytoplasmic
NCBI Official Synonym Full Names
isoleucine-tRNA synthetase
NCBI Official Symbol
Iars
NCBI Official Synonym Symbols
ILRS; AI327140; AU044614; 2510016L12Rik; E430001P04Rik
NCBI Protein Information
isoleucine--tRNA ligase, cytoplasmic
UniProt Protein Name
Isoleucine--tRNA ligase, cytoplasmic
UniProt Gene Name
Iars
UniProt Synonym Gene Names
IRS; IleRS

Similar Products

Product Notes

The Iars iars (Catalog #AAA18749) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 732-831aa; Partial. The amino acid sequence is listed below: NWYVRMNRRR LKGESGVEDC VMALETLFSV LLSLCRLMAP YTPFLTELMY QNLKLLIDPA SLRDKDTLSI HYLMLPRVRE ELIDKKTENA VSRMQSVIEL . It is sometimes possible for the material contained within the vial of "Isoleucine--tRNA ligase, cytoplasmic (Iars), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.