Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Cart Login
product-image-AAA18756_SDS_PAGE.jpg
SDS-PAGE

Pectate lyase 1 Recombinant Protein

Recombinant Cupressus arizonica Pectate lyase 1

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Pectate lyase 1; N/A; Recombinant Cupressus arizonica Pectate lyase 1; Major pollen allergen Cup a 1; Allergen=; Cup a 1; Pectate lyase 1 recombinant protein
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
22-367aa; Full Length of Mature Protein
Sequence
DNPIDSCWRGDSNWDQNRMKLADCVVGFGSSTMGGKGGEIYTVTSSEDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGADVHLGNGGPCLFMRKASHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNESYKKEVTKRIGCETTSACANWVWRSTRDAFTNGAYFVSSGKAEDTNIYNSNEAFKVENGNAAPQLTQNAGVVA
Species
Cupressus arizonica (Arizona cypress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

Related Product Information for Pectate lyase 1 recombinant protein
Has pectate lyase activity.

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
40.1
NCBI Official Full Name
Pectate lyase 1
UniProt Protein Name
Pectate lyase 1
UniProt Entry Name
PLY1_CUPAR

Similar Products

product-image-AAA18756_SDS_PAGE.jpg

Pectate lyase 1 Recombinant Protein

Host: E Coli or Yeast or Baculovirus or Mammalian Cell
Reactivity: n/a
Apps: n/a
product-image-AAA19128_SC.jpg

Interferon Gamma ELISA Kit

Host: n/a
Reactivity: Human
Apps: n/a
product-image-AAA22544_SC.jpg

Anti-interferon antibody (Anti-IFN-ab) ELISA ELISA Kit

Host: n/a
Reactivity: Human
Apps: n/a
product-image-AAA15845_SC.png

Interferon-Tau ELISA Kit

Host: n/a
Reactivity: Bovine
Apps: n/a
product-image-AAA15764_SC.png

anti-Smith antibody ELISA Kit

Host: n/a
Reactivity: Mouse
Apps: n/a
product-image-AAA27280_SC.jpg

anti Mi2 antibody ELISA Kit

Host: n/a
Reactivity: Human
Apps: n/a
product-image-AAA12616_SC.jpg

anti-phospholipid antibody ELISA Kit

Host: n/a
Reactivity: Mouse
Apps: n/a
product-image-AAA27143_SC.jpg

Annexin A2 antibody ELISA Kit

Host: n/a
Reactivity: Human
Apps: n/a
product-image-AAA27258_SC.jpg

anti cyclic citrullinated peptide antibody (anti CCP antibody) ELISA Kit

Host: n/a
Reactivity: Human
Apps: n/a
product-image-AAA15250_SC.png

Anti-Cyclic Citrullinated Peptide Antibody (Anti-CCP-antibody) ELISA Kit

Host: n/a
Reactivity: Rat
Apps: n/a
product-image-AAA27214_SC.jpg

anti-neutrophil antibody, ANA ELISA Kit

Host: n/a
Reactivity: Mouse
Apps: n/a
product-image-AAA15611_SC.png

anti-nucleosome antibody (IgG) ELISA Kit

Host: n/a
Reactivity: Mouse
Apps: n/a
product-image-AAA27180_SC.jpg

anti-cyclic citrullinated peptide antibody (anti-CCP antibody) ELISA Kit

Host: n/a
Reactivity: Mouse
Apps: n/a
product-image-AAA27832_SC.jpg

Isocitrate Lyase Assay Kit

Host: n/a
Reactivity: General
Apps: Functional Assay
product-image-AAA27139_SC.jpg

anti-nucleolus antibody, ANA ELISA Kit

Host: n/a
Reactivity: Mouse
Apps: n/a
product-image-AAA27324_SC.jpg

anti-SSA/Ro antibody ELISA Kit

Host: n/a
Reactivity: Mouse
Apps: n/a
product-image-AAA27381_SC.jpg

Anti-carbamylated Protein Antibody ELISA Kit

Host: n/a
Reactivity: Human
Apps: n/a

Product Notes

The Pectate lyase 1 (Catalog #AAA18756) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-367aa; Full Length of Mature Protein. The amino acid sequence is listed below: DNPIDSCWRG DSNWDQNRMK LADCVVGFGS STMGGKGGEI YTVTSSEDNP VNPTPGTLRY GATREKALWI IFSQNMNIKL QMPLYVAGYK TIDGRGADVH LGNGGPCLFM RKASHVILHG LHIHGCNTSV LGDVLVSESI GVEPVHAQDG DAITMRNVTN AWIDHNSLSD CSDGLIDVTL GSTGITISNN HFFNHHKVML LGHDDTYDDD KSMKVTVAFN QFGPNAGQRM PRARYGLVHV ANNNYDQWNI YAIGGSSNPT ILSEGNSFTA PNESYKKEVT KRIGCETTSA CANWVWRSTR DAFTNGAYFV SSGKAEDTNI YNSNEAFKVE NGNAAPQLTQ NAGVVA . It is sometimes possible for the material contained within the vial of "Pectate lyase 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.