Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

WB (Western Blot) (WB Suggested Anti-CAMKK2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysateThere is BioGPS gene expression data showing that CAMKK2 is expressed in 721_B)

Rabbit CAMKK2 Polyclonal Antibody | anti-CAMKK2 antibody

CAMKK2 antibody - N-terminal region

Gene Names
CAMKK2; CAMKK; CAMKKB
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CAMKK2; Polyclonal Antibody; CAMKK2 antibody - N-terminal region; anti-CAMKK2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GGLAAGGSLDMNGRCICPSLPYSPVSSPQSSPRLPRRPTVESHHVSITGM
Sequence Length
498
Applicable Applications for anti-CAMKK2 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 86%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 93%; Rat: 86%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CAMKK2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CAMKK2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysateThere is BioGPS gene expression data showing that CAMKK2 is expressed in 721_B)

WB (Western Blot) (WB Suggested Anti-CAMKK2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysateThere is BioGPS gene expression data showing that CAMKK2 is expressed in 721_B)

WB (Western Blot)

(Host: RabbitTarget Name: CAMKK2Sample Type: Human MCF7Antibody Dilution: 1.0ug/mlCAMKK2 is supported by BioGPS gene expression data to be expressed in MCF7)

WB (Western Blot) (Host: RabbitTarget Name: CAMKK2Sample Type: Human MCF7Antibody Dilution: 1.0ug/mlCAMKK2 is supported by BioGPS gene expression data to be expressed in MCF7)

WB (Western Blot)

(Host: RabbitTarget Name: CAMKK2Sample Type: Human JurkatAntibody Dilution: 1.0ug/mlCAMKK2 is supported by BioGPS gene expression data to be expressed in Jurkat)

WB (Western Blot) (Host: RabbitTarget Name: CAMKK2Sample Type: Human JurkatAntibody Dilution: 1.0ug/mlCAMKK2 is supported by BioGPS gene expression data to be expressed in Jurkat)

WB (Western Blot)

(Host: RabbitTarget Name: CAMKK2Sample Type: Human HepG2Antibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that CAMKK2 is expressed in HepG2)

WB (Western Blot) (Host: RabbitTarget Name: CAMKK2Sample Type: Human HepG2Antibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that CAMKK2 is expressed in HepG2)

WB (Western Blot)

(Host: RabbitTarget Name: CAMKK2Sample Type: Human HelaAntibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that CAMKK2 is expressed in HeLa)

WB (Western Blot) (Host: RabbitTarget Name: CAMKK2Sample Type: Human HelaAntibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that CAMKK2 is expressed in HeLa)

WB (Western Blot)

(Host: RabbitTarget Name: CAMKK2Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

WB (Western Blot) (Host: RabbitTarget Name: CAMKK2Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: CAMKK2Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

WB (Western Blot) (Host: RabbitTarget Name: CAMKK2Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CAMKK2 antibody
This is a rabbit polyclonal antibody against CAMKK2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CAMKK2 is a calcium/calmodulin-dependent protein kinase belonging to a proposed calcium-triggered signaling cascade involved in a number of cellular processes. Isoform 1, isoform 2 and isoform 3 phosphorylate CAMK1 and CAMK4. Isoform 3 phosphorylates CAMK1D. Isoform 4, isoform 5 and isoform 6 lacking part of the calmodulin-binding domain are inactive. CAMKK2 seems to be involved in hippocampal activation of CREB1.The product of this gene belongs to the Serine/Threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. This protein plays a role in the calcium/calmodulin-dependent (CaM) kinase cascade by phosphorylating the downstream kinases CaMK1 and CaMK4. Seven transcript variants encoding six distinct isoforms have been identified for this gene. Additional splice variants have been described but their full-length nature has not been determined. The identified isoforms exhibit a distinct ability to undergo autophosphorylation and to phosphorylate the downstream kinases.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
calcium/calmodulin-dependent protein kinase kinase 2 isoform 4
NCBI Official Synonym Full Names
calcium/calmodulin dependent protein kinase kinase 2
NCBI Official Symbol
CAMKK2
NCBI Official Synonym Symbols
CAMKK; CAMKKB
NCBI Protein Information
calcium/calmodulin-dependent protein kinase kinase 2
UniProt Protein Name
Calcium/calmodulin-dependent protein kinase kinase 2
UniProt Gene Name
CAMKK2
UniProt Synonym Gene Names
CAMKKB; KIAA0787; CaM-KK 2; CaM-kinase kinase 2; CaMKK 2; CaM-KK beta; CaM-kinase kinase beta; CaMKK beta
UniProt Entry Name
KKCC2_HUMAN

Similar Products

Product Notes

The CAMKK2 camkk2 (Catalog #AAA23549) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CAMKK2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CAMKK2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CAMKK2 camkk2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GGLAAGGSLD MNGRCICPSL PYSPVSSPQS SPRLPRRPTV ESHHVSITGM. It is sometimes possible for the material contained within the vial of "CAMKK2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.