Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

WB (Western Blot) (WB Suggested Anti-DEPDC1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human brain)

Rabbit DEPDC1 Polyclonal Antibody | anti-DEPDC1 antibody

DEPDC1 antibody - middle region

Gene Names
DEPDC1; DEP.8; SDP35; DEPDC1A; DEPDC1-V2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DEPDC1; Polyclonal Antibody; DEPDC1 antibody - middle region; anti-DEPDC1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PEPLLTFEYYELFVNILVVCGYITVSDRSSGIHKIQDDPQSSKFLHLNNL
Sequence Length
811
Applicable Applications for anti-DEPDC1 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 92%; Rabbit: 86%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human DEPDC1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-DEPDC1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human brain)

WB (Western Blot) (WB Suggested Anti-DEPDC1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human brain)

WB (Western Blot)

(Host: RabbitTarget Name: WT1Sample Type: 721_BAntibody Dilution: 1.0ug/mlDEPDC1 is supported by BioGPS gene expression data to be expressed in 721_B)

WB (Western Blot) (Host: RabbitTarget Name: WT1Sample Type: 721_BAntibody Dilution: 1.0ug/mlDEPDC1 is supported by BioGPS gene expression data to be expressed in 721_B)

WB (Western Blot)

(Host: RabbitTarget Name: SERPINA3Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

WB (Western Blot) (Host: RabbitTarget Name: SERPINA3Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: HIRIP3Sample Type: 293TAntibody Dilution: 1.0ug/mlDEPDC1 is supported by BioGPS gene expression data to be expressed in HEK293T)

WB (Western Blot) (Host: RabbitTarget Name: HIRIP3Sample Type: 293TAntibody Dilution: 1.0ug/mlDEPDC1 is supported by BioGPS gene expression data to be expressed in HEK293T)

WB (Western Blot)

(Host: RabbitTarget Name: FAM46CSample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

WB (Western Blot) (Host: RabbitTarget Name: FAM46CSample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: EGFL8Sample Type: HelaAntibody Dilution: 1.0ug/mlDEPDC1 is supported by BioGPS gene expression data to be expressed in HeLa)

WB (Western Blot) (Host: RabbitTarget Name: EGFL8Sample Type: HelaAntibody Dilution: 1.0ug/mlDEPDC1 is supported by BioGPS gene expression data to be expressed in HeLa)
Related Product Information for anti-DEPDC1 antibody
This is a rabbit polyclonal antibody against DEPDC1. It was validated on Western Blot

Target Description: The function of DEPDC1 remains unknown.
Product Categories/Family for anti-DEPDC1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
89kDa
NCBI Official Full Name
DEP domain-containing protein 1A isoform a
NCBI Official Synonym Full Names
DEP domain containing 1
NCBI Official Symbol
DEPDC1
NCBI Official Synonym Symbols
DEP.8; SDP35; DEPDC1A; DEPDC1-V2
NCBI Protein Information
DEP domain-containing protein 1A
UniProt Protein Name
DEP domain-containing protein 1A
UniProt Gene Name
DEPDC1
UniProt Synonym Gene Names
DEPDC1A
UniProt Entry Name
DEP1A_HUMAN

Similar Products

Product Notes

The DEPDC1 depdc1 (Catalog #AAA23565) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DEPDC1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DEPDC1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DEPDC1 depdc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PEPLLTFEYY ELFVNILVVC GYITVSDRSS GIHKIQDDPQ SSKFLHLNNL. It is sometimes possible for the material contained within the vial of "DEPDC1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.