Mouse anti-Human BPNT1 Monoclonal Antibody | anti-BPNT1 antibody

BPNT1 (3'(2'),5'-bisphosphate nucleotidase 1, Bisphosphate 3'-nucleotidase 1, PAP-inositol 1,4-phosphatase)

Cat. Num. AAA24061

• Gene Names: BPNT1; PIP
• Reactivity: Human
• Applications: ELISA, Western Blot, Immunohistochemistry, Immunofluorescence
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: BPNT1; Monoclonal Antibody; BPNT1 (3'(2'); 5'-bisphosphate nucleotidase 1; Bisphosphate 3'-nucleotidase 1; PAP-inositol 1; 4-phosphatase); Anti -BPNT1 (3'(2'); anti-BPNT1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2E1
• Specificity: Recognizes human BPNT1.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MASSNTVLMRLVASAYSIAQKAGMIVRRVIAEGDLGIVEKTCATDLQTKADRLAQMSICSSLARKFPKLTIIGEEDLPSEEVDQELIEDSQWEEILKQPC

• Applicable Applications for anti-BPNT1 antibody: ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
• Application Notes: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry.; Dilution: Immunofluorescence: 10ug/ml; Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
• Immunogen: Partial recombinant corresponding to aa1-100 from BPNT1 (NP_006076) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(BPNT1 monoclonal antibody Western Blot analysis of BPNT1 expression in HeLa.)

Application Data

(Detection limit for recombinant GST tagged BPNT1 is ~0.03ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to BPNT1 on HeLa cell. [antibody concentration 10ug/ml])

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to BPNT1 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3ug/ml])

WB (Western Blot)

(Western Blot analysis of BPNT1 expression in transfected 293T cell line by BPNT1 monoclonal antibody.Lane 1: BPNT1 transfected lysate (28.1kD).Lane 2: Non-transfected lysate.)

WB (Western Blot)

(Western Blot detection against Immunogen (36.74kD).)

Related Product Information for anti-BPNT1 antibody

BPNT1, also called bisphosphate 3-prime-nucleotidase, or BPntase, is a member of a magnesium-dependent phosphomonoesterase family. Lithium, a major drug used to treat manic depression, acts as an uncompetitive inhibitor of BPntase. The predicted human protein is 92% identical to mouse BPntase. BPntase's physiologic role in nucleotide metabolism may be regulated by inositol signaling pathways. The inhibition of human BPntase may account for lithium-induced nephrotoxicity.

Product Categories/Family for anti-BPNT1 antibody

Antibodies; Abs to Enzymes; Nucleotidase

NCBI and Uniprot Product Information

• NCBI GI #: 17389533
• NCBI GeneID: 10380
• UniProt Accession #: O95861; Q8WVL5; Q9UGJ3; A8K7C8; D3DTA9
• Molecular Weight: 33,392 Da
• NCBI Official Full Name: BPNT1 protein
• NCBI Official Synonym Full Names: 3'(2'), 5'-bisphosphate nucleotidase 1
• NCBI Official Symbol: BPNT1
• NCBI Official Synonym Symbols: PIP
• NCBI Protein Information: 3'(2'),5'-bisphosphate nucleotidase 1; 3'(2'),5'-bisphosphate nucleotidase 1; BPntase; PAP-inositol 1,4-phosphatase; PAP-inositol-1,4-phosphatase; bisphosphate 3'-nucleotidase 1
• UniProt Protein Name: 3'(2'),5'-bisphosphate nucleotidase 1
• UniProt Gene Name: BPNT1
• UniProt Synonym Gene Names: PIP
• UniProt Entry Name: BPNT1_HUMAN