<
WB (Western Blot)
(Western blot analysis of PDK2 over-expressed 293 cell line, cotransfected with PDK2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PDK2 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)
Mouse anti-Human PDHK2 [Pyruvate Dehydrogenase [Lipoamide]] Kinase Isozyme 2, Mitochondrial, Pyruvate Dehydrogenase Kinase Isoform 2, PDH Kinase 2, PDKII, PDK2) Monoclonal Antibody | anti-PDK2 antibody
PDHK2 [Pyruvate Dehydrogenase [Lipoamide]] Kinase Isozyme 2, Mitochondrial, Pyruvate Dehydrogenase Kinase Isoform 2, PDH Kinase 2, PDKII, PDK2)
Gene Names
PDK2; PDHK2; PDKII
Reactivity
Human
Applications
ELISA, Western Blot, Immunohistochemistry
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
PDHK2 [Pyruvate Dehydrogenase [Lipoamide]] Kinase Isozyme 2; Mitochondrial; Pyruvate Dehydrogenase Kinase Isoform 2; PDH Kinase 2; PDKII; PDK2); Monoclonal Antibody; Anti -PDHK2 [Pyruvate Dehydrogenase [Lipoamide]] Kinase Isozyme 2; anti-PDK2 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2G1
Specificity
Recognizes human PDK2.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
HIGSIDPNCNVSEVVKDAYDMAKLLCDKYYMASPDLEIQEINAANSKQPIHMVYVPSHLYHMLFELFKNAMRATVESHESSLILPPIKVM
Applicable Applications for anti-PDK2 antibody
ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
Suitable for use in ELISA, Western Blot and Immunohistochemistry.
Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 0.8ug/ml
Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 0.8ug/ml
Immunogen
Partial recombinant corresponding to aa187-276 from human PDK2 (AAH05811) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
WB (Western Blot)
(Western blot analysis of PDK2 over-expressed 293 cell line, cotransfected with PDK2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PDK2 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)
WB (Western Blot)
(Western blot analysis of PDK2 over-expressed 293 cell line, cotransfected with PDK2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PDK2 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)
Application Data
(Detection limit for recombinant GST tagged PDK2 is ~0.3ng/ml as a capture antibody.)
Application Data
(Detection limit for recombinant GST tagged PDK2 is ~0.3ng/ml as a capture antibody.)
IHC (Immunohistochemistry)
(Immunoperoxidase of monoclonal antibody to PDK2 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 0.8ug/ml])
IHC (Immunohistochemistry)
(Immunoperoxidase of monoclonal antibody to PDK2 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 0.8ug/ml])
WB (Western Blot)
(Western Blot analysis of PDK2 expression in transfected 293T cell line by PDK2 monoclonal antibody.Lane 1: PDK2 transfected lysate (46.2kD).Lane 2: Non-transfected lysate.)
WB (Western Blot)
(Western Blot analysis of PDK2 expression in transfected 293T cell line by PDK2 monoclonal antibody.Lane 1: PDK2 transfected lysate (46.2kD).Lane 2: Non-transfected lysate.)
WB (Western Blot)
(PDK2 monoclonal antibody Western Blot analysis of PDK2 expression in U-2 OS.)
WB (Western Blot)
(PDK2 monoclonal antibody Western Blot analysis of PDK2 expression in U-2 OS.)
WB (Western Blot)
(Western Blot detection against Immunogen (35.31kD).)
WB (Western Blot)
(Western Blot detection against Immunogen (35.31kD).)
Related Product Information for anti-PDK2 antibody
Inhibits the mitochondrial pyruvate dehydrogenase complex by phosphorylation of the E1 alpha subunit, thus contributing to the regulation of glucose metabolism.
Product Categories/Family for anti-PDK2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
46,154 Da
NCBI Official Full Name
pyruvate dehydrogenase kinase, isozyme 2 isoform 2
NCBI Official Synonym Full Names
pyruvate dehydrogenase kinase, isozyme 2
NCBI Official Symbol
PDK2
NCBI Official Synonym Symbols
PDHK2; PDKII
NCBI Protein Information
pyruvate dehydrogenase kinase, isozyme 2; PDH kinase 2; pyruvate dehydrogenase kinase, isoenzyme 2; pyruvate dehydrogenase, lipoamide, kinase isozyme 2, mitochondrial
UniProt Protein Name
[Pyruvate dehydrogenase [lipoamide]] kinase isozyme 2, mitochondrial
UniProt Gene Name
PDK2
UniProt Synonym Gene Names
PDHK2; PDH kinase 2; PDKII
UniProt Entry Name
PDK2_HUMAN
Similar Products
Product Notes
The PDK2 pdk2 (Catalog #AAA24094) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PDHK2 [Pyruvate Dehydrogenase [Lipoamide]] Kinase Isozyme 2, Mitochondrial, Pyruvate Dehydrogenase Kinase Isoform 2, PDH Kinase 2, PDKII, PDK2) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PDHK2 [Pyruvate Dehydrogenase [Lipoamide]] Kinase Isozyme 2, Mitochondrial, Pyruvate Dehydrogenase Kinase Isoform 2, PDH Kinase 2, PDKII, PDK2) can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC). Suitable for use in ELISA, Western Blot and Immunohistochemistry. Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 0.8ug/ml. Researchers should empirically determine the suitability of the PDK2 pdk2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: HIGSIDPNCN VSEVVKDAYD MAKLLCDKYY MASPDLEIQE INAANSKQPI HMVYVPSHLY HMLFELFKNA MRATVESHES SLILPPIKVM. It is sometimes possible for the material contained within the vial of "PDHK2 [Pyruvate Dehydrogenase [Lipoamide]] Kinase Isozyme 2, Mitochondrial, Pyruvate Dehydrogenase Kinase Isoform 2, PDH Kinase 2, PDKII, PDK2), Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
