Mouse anti-Human, Mouse CPSF6 Monoclonal Antibody | anti-CPSF6 antibody

CPSF6 (CFIM68, Cleavage and Polyadenylation Specificity Factor Subunit 6, Cleavage and Polyadenylation Specificity Factor 68kD Subunit, Pre-mRNA Cleavage Factor Im 68kD Subunit, Protein HPBRII-4/7)

Cat. Num. AAA24101

• Gene Names: CPSF6; CFIM; CFIM68; HPBRII-4; HPBRII-7
• Reactivity: Human, Mouse
• Applications: ELISA, Western Blot, Immunofluorescence
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: CPSF6, Antibody; CPSF6 (CFIM68, Cleavage and Polyadenylation Specificity Factor Subunit 6, Cleavage and Polyadenylation Specificity Factor 68kD Subunit, Pre-mRNA Cleavage Factor Im 68kD Subunit, Protein HPBRII-4/7); Anti -CPSF6 (CFIM68, Cleavage and Polyadenylation Specificity Factor Subunit 6, Cleavage and Polyadenylation Specificity Factor 68kD Subunit, Pre-mRNA Cleavage Factor Im 68kD Subunit, Protein HPBRII-4/7); anti-CPSF6 antibody

• Host: Mouse
• Reactivity: Human, Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3F11
• Specificity: Recognizes human CPSF6. Species Crossreactivity: mouse.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: ISPSANNGDAPEDRDYMDTLPPTVGDDVGKGAAPNVVYTYTGKRIALYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGVGSEAS

• Applicable Applications for anti-CPSF6 antibody: ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF)
• Application Notes: Suitable for use in Immunofluorescence, ELISA and Western Blot.; Dilution: Immunofluorescence: 10ug/ml
• Immunogen: Partial recombinant corresponding to aa37-137 from human CPSF6 (NP_008938) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(Western Blot detection against Immunogen (37.11kD).)

WB (Western Blot)

(CPSF6 monoclonal antibody Western Blot analysis of CPSF6 expression in HeLa.)

Application Data

(Detection limit for recombinant GST tagged CPSF6 is ~0.03ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to CPSF6 on HeLa cell. [antibody concentration 10ug/ml].)

WB (Western Blot)

(Western Blot analysis of CPSF6 expression in transfected 293T cell line by CPSF6 monoclonal antibody.Lane 1: CPSF6 transfected lysate (59.21kD).Lane 2: Non-transfected lysate.)

WB (Western Blot)

(CPSF6 monoclonal antibody Western Blot analysis of CPSF6 expression in Raw 264.7.)

WB (Western Blot)

(CPSF6 monoclonal antibody . Western Blot analysis of CPSF6 expression in HL-60.)

Related Product Information for anti-CPSF6 antibody

Component of the cleavage factor Im complex (CFIm) that plays a key role in pre-mRNA 3'-processing. Involved in association with NUDT21/CPSF5 in pre-MRNA 3'-end poly(A) site cleavage and poly(A) addition. CPSF6 binds to cleavage and polyadenylation RNA substrates and promotes RNA looping.

Product Categories/Family for anti-CPSF6 antibody

Antibodies; Abs to Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 162329583
• NCBI GeneID: 11052
• NCBI Accession #: NP_008938.2
• NCBI GenBank Nucleotide #: NM_007007.2
• UniProt Accession #: Q16630; Q53ES1; Q9BSJ7; Q9BW18; A8K7K9
• Molecular Weight: 59,210 Da
• NCBI Official Full Name: cleavage and polyadenylation specificity factor subunit 6
• NCBI Official Synonym Full Names: cleavage and polyadenylation specific factor 6, 68kDa
• NCBI Official Symbol: CPSF6
• NCBI Official Synonym Symbols: CFIM; CFIM68; HPBRII-4; HPBRII-7
• NCBI Protein Information: cleavage and polyadenylation specificity factor subunit 6; protein HPBRII-4/7; CPSF 68 kDa subunit; pre-mRNA cleavage factor Im (68kD); pre-mRNA cleavage factor I, 68kD subunit; cleavage factor Im complex 68 kDa subunit; pre-mRNA cleavage factor Im 68 kDa subunit; cleavage and polyadenylation specificity factor 68 kDa subunit
• UniProt Protein Name: Cleavage and polyadenylation specificity factor subunit 6
• UniProt Gene Name: CPSF6
• UniProt Synonym Gene Names: CFIM68; CFIm68
• UniProt Entry Name: CPSF6_HUMAN