Loading...

Skip to main content
WB (Western Blot) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human, Mouse CPSF6 Monoclonal Antibody | anti-CPSF6 antibody

CPSF6 (CFIM68, Cleavage and Polyadenylation Specificity Factor Subunit 6, Cleavage and Polyadenylation Specificity Factor 68kD Subunit, Pre-mRNA Cleavage Factor Im 68kD Subunit, Protein HPBRII-4/7) (HRP)

Gene Names
CPSF6; CFIM; CFIM68; CFIM72; HPBRII-4; HPBRII-7
Reactivity
Human, Mouse
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CPSF6, Antibody; CPSF6 (CFIM68, Cleavage and Polyadenylation Specificity Factor Subunit 6, Cleavage and Polyadenylation Specificity Factor 68kD Subunit, Pre-mRNA Cleavage Factor Im 68kD Subunit, Protein HPBRII-4/7) (HRP); anti-CPSF6 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3F11
Specificity
Recognizes human CPSF6. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-CPSF6 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa37-137 from human CPSF6 (NP_008938) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ISPSANNGDAPEDRDYMDTLPPTVGDDVGKGAAPNVVYTYTGKRIALYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGVGSEAS
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(Western Blot detection against Immunogen (37.11kD).)

WB (Western Blot) (Western Blot detection against Immunogen (37.11kD).)

WB (Western Blot)

(CPSF6 monoclonal antibody Western Blot analysis of CPSF6 expression in HeLa.)

WB (Western Blot) (CPSF6 monoclonal antibody Western Blot analysis of CPSF6 expression in HeLa.)

Application Data

(Detection limit for recombinant GST tagged CPSF6 is ~0.03ng/ml as a capture antibody.)

Application Data (Detection limit for recombinant GST tagged CPSF6 is ~0.03ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to CPSF6 on HeLa cell. [antibody concentration 10ug/ml].)

IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to CPSF6 on HeLa cell. [antibody concentration 10ug/ml].)

WB (Western Blot)

(Western Blot analysis of CPSF6 expression in transfected 293T cell line by CPSF6 monoclonal antibody. Lane 1: CPSF6 transfected lysate (59.21kD). Lane 2: Non-transfected lysate.)

WB (Western Blot) (Western Blot analysis of CPSF6 expression in transfected 293T cell line by CPSF6 monoclonal antibody. Lane 1: CPSF6 transfected lysate (59.21kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(CPSF6 monoclonal antibody Western Blot analysis of CPSF6 expression in Raw 264.7.)

WB (Western Blot) (CPSF6 monoclonal antibody Western Blot analysis of CPSF6 expression in Raw 264.7.)

WB (Western Blot)

(CPSF6 monoclonal antibody. Western Blot analysis of CPSF6 expression in HL-60.)

WB (Western Blot) (CPSF6 monoclonal antibody. Western Blot analysis of CPSF6 expression in HL-60.)
Related Product Information for anti-CPSF6 antibody
Component of the cleavage factor Im complex (CFIm) that plays a key role in pre-mRNA 3'-processing. Involved in association with NUDT21/CPSF5 in pre-MRNA 3'-end poly(A) site cleavage and poly(A) addition. CPSF6 binds to cleavage and polyadenylation RNA substrates and promotes RNA looping.
Product Categories/Family for anti-CPSF6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61kDa
NCBI Official Full Name
cleavage and polyadenylation specificity factor subunit 6 isoform 1
NCBI Official Synonym Full Names
cleavage and polyadenylation specific factor 6
NCBI Official Symbol
CPSF6
NCBI Official Synonym Symbols
CFIM; CFIM68; CFIM72; HPBRII-4; HPBRII-7
NCBI Protein Information
cleavage and polyadenylation specificity factor subunit 6
UniProt Protein Name
Cleavage and polyadenylation specificity factor subunit 6
UniProt Gene Name
CPSF6
UniProt Synonym Gene Names
CFIM68
UniProt Entry Name
CPSF6_HUMAN

Similar Products

Product Notes

The CPSF6 cpsf6 (Catalog #AAA25357) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CPSF6 (CFIM68, Cleavage and Polyadenylation Specificity Factor Subunit 6, Cleavage and Polyadenylation Specificity Factor 68kD Subunit, Pre-mRNA Cleavage Factor Im 68kD Subunit, Protein HPBRII-4/7) (HRP) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's CPSF6 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CPSF6 cpsf6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CPSF6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.