Mouse anti-Human GSC Monoclonal Antibody | anti-GSC antibody

GSC (Homeobox Protein Goosecoid) (AP)

Cat. Num. AAA24229

• Gene Names: GSC; SAMS
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: GSC, Antibody; GSC (Homeobox Protein Goosecoid) (AP); anti-GSC antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG
• Clone Number: 3D11
• Specificity: Recognizes human GSC.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-GSC antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant protein corresponding to aa151-258 from human GSC (NP_776248) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LLNQLHCRRKRRHRTIFTDEQLEALENLFQETKYPDVGTREQLARKVHLREEKVEVWFKNRRAKWRRQKRSSSEESENAEKWNKTSSSKASPEKREEEGKSDLDSDS
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(Western blot analysis of GSC over-expressed 293 cell line, cotransfected with GSC Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with GSC monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Application Data

(Detection limit for recombinant GST tagged GSC is ~0.3ng/ml as a capture antibody.)

WB (Western Blot)

(Western Blot analysis of GSC expression in transfected 293T cell line by GSC monoclonal antibody. Lane 1: GSC transfected lysate (28.1kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(GSC monoclonal antibody. Western Blot analysis of GSC expression in SJCRH30.)

WB (Western Blot)

(GSC monoclonal antibody. Western Blot analysis of GSC expression in COLO 320 HSR.)

WB (Western Blot)

(Western Blot detection against Immunogen (37.88kD).)

Related Product Information for anti-GSC antibody

Regulates chordin (CHRD). May play a role in spatial programing within discrete embryonic fields or lineage compartments during organogenesis. In concert with NKX3-2, plays a role in defining the structural components of the middle ear; required for the development of the entire tympanic ring.

Product Categories/Family for anti-GSC antibody

Antibodies; Transcription Factors; Homeobox (HOX)

NCBI and Uniprot Product Information

• NCBI GI #: 27777663
• NCBI GeneID: 145258
• NCBI Accession #: NP_776248
• NCBI GenBank Nucleotide #: NM_173849
• UniProt Accession #: P56915; Q86YR1
• Molecular Weight: 28,150 Da
• NCBI Official Full Name: homeobox protein goosecoid
• NCBI Official Synonym Full Names: goosecoid homeobox
• NCBI Official Symbol: GSC
• NCBI Official Synonym Symbols: SAMS
• NCBI Protein Information: homeobox protein goosecoid
• UniProt Protein Name: Homeobox protein goosecoid
• UniProt Gene Name: GSC
• UniProt Entry Name: GSC_HUMAN