Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA24820_WB6.jpg WB (Western Blot) (Western blot analysis of GSC over-expressed 293 cell line, cotransfected with GSC Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with GSC monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Mouse anti-Human GSC Monoclonal Antibody | anti-GSC antibody

GSC (Homeobox Protein Goosecoid) (Biotin)

Gene Names
GSC; SAMS
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GSC, Antibody; GSC (Homeobox Protein Goosecoid) (Biotin); anti-GSC antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Clone Number
3D11
Specificity
Recognizes human GSC.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-GSC antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa151-258 from human GSC (NP_776248) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LLNQLHCRRKRRHRTIFTDEQLEALENLFQETKYPDVGTREQLARKVHLREEKVEVWFKNRRAKWRRQKRSSSEESENAEKWNKTSSSKASPEKREEEGKSDLDSDS
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(Western blot analysis of GSC over-expressed 293 cell line, cotransfected with GSC Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with GSC monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

product-image-AAA24820_WB6.jpg WB (Western Blot) (Western blot analysis of GSC over-expressed 293 cell line, cotransfected with GSC Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with GSC monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Application Data

(Detection limit for recombinant GST tagged GSC is ~0.3ng/ml as a capture antibody.)

product-image-AAA24820_APP5.jpg Application Data (Detection limit for recombinant GST tagged GSC is ~0.3ng/ml as a capture antibody.)

WB (Western Blot)

(Western Blot analysis of GSC expression in transfected 293T cell line by GSC monoclonal antibody. Lane 1: GSC transfected lysate (28.1kD). Lane 2: Non-transfected lysate.)

product-image-AAA24820_WB4.jpg WB (Western Blot) (Western Blot analysis of GSC expression in transfected 293T cell line by GSC monoclonal antibody. Lane 1: GSC transfected lysate (28.1kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(GSC monoclonal antibody. Western Blot analysis of GSC expression in SJCRH30.)

product-image-AAA24820_WB3.jpg WB (Western Blot) (GSC monoclonal antibody. Western Blot analysis of GSC expression in SJCRH30.)

WB (Western Blot)

(GSC monoclonal antibody. Western Blot analysis of GSC expression in COLO 320 HSR.)

product-image-AAA24820_WB2.jpg WB (Western Blot) (GSC monoclonal antibody. Western Blot analysis of GSC expression in COLO 320 HSR.)

WB (Western Blot)

(Western Blot detection against Immunogen (37.88kD).)

product-image-AAA24820_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (37.88kD).)
Related Product Information for anti-GSC antibody
Regulates chordin (CHRD). May play a role in spatial programing within discrete embryonic fields or lineage compartments during organogenesis. In concert with NKX3-2, plays a role in defining the structural components of the middle ear; required for the development of the entire tympanic ring.
Product Categories/Family for anti-GSC antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28,150 Da
NCBI Official Full Name
homeobox protein goosecoid
NCBI Official Synonym Full Names
goosecoid homeobox
NCBI Official Symbol
GSC
NCBI Official Synonym Symbols
SAMS
NCBI Protein Information
homeobox protein goosecoid
UniProt Protein Name
Homeobox protein goosecoid
UniProt Gene Name
GSC
UniProt Entry Name
GSC_HUMAN

Similar Products

Product Notes

The GSC gsc (Catalog #AAA24820) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GSC (Homeobox Protein Goosecoid) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GSC can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GSC gsc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GSC, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.