Mouse PGRMC2 Monoclonal Antibody | anti-PGRMC2 antibody

PGRMC2 (Membrane-associated Progesterone Receptor Component 2, Progesterone Membrane-binding Protein, Steroid Receptor Protein DG6, DG6, PMBP) (AP)

Cat. Num. AAA24312

• Gene Names: PGRMC2; DG6; PMBP
• Reactivity: Human, Mouse, Rat
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PGRMC2, Antibody; PGRMC2 (Membrane-associated Progesterone Receptor Component 2, Progesterone Membrane-binding Protein, Steroid Receptor Protein DG6, DG6, PMBP) (AP); anti-PGRMC2 antibody

• Host: Mouse
• Reactivity: Human, Mouse, Rat
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3C11
• Specificity: Recognizes human PGRMC2. Species Crossreactivity: mouse and rat.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
• Sequence Length: 2769

• Applicable Applications for anti-PGRMC2 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 1ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa124-223 from PGRMC2 (NP_006311) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: NGKVFDVTKGSKFYGPAGPYGIFAGRDASRGLATFCLDKDALRDEYDDLSDLNAVQMESVREWEMQFKEKYDYVGRLLKPGEEPSEYTDEEDTKDHNKQD
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(Western Blot detection against Immunogen (37.11kD).)

Product Categories/Family for anti-PGRMC2 antibody

Antibodies; Hormones; Steroids

NCBI and Uniprot Product Information

• NCBI GI #: 1524119252
• NCBI GeneID: 10424
• NCBI Accession #: NM_006320.6
• NCBI GenBank Nucleotide #: NM_006320
• UniProt Accession #: O15173
• NCBI Official Full Name: Homo sapiens progesterone receptor membrane component 2 (PGRMC2), mRNA
• NCBI Official Synonym Full Names: progesterone receptor membrane component 2
• NCBI Official Symbol: PGRMC2
• NCBI Official Synonym Symbols: DG6; PMBP
• NCBI Protein Information: membrane-associated progesterone receptor component 2
• UniProt Protein Name: Membrane-associated progesterone receptor component 2
• UniProt Gene Name: PGRMC2
• UniProt Synonym Gene Names: DG6; PMBP
• UniProt Entry Name: PGRC2_HUMAN