Mouse anti-Human UBE2C Monoclonal Antibody | anti-UBE2C antibody

UBE2C (Ubiquitin-conjugating Enzyme E2 C, UbcH10, Ubiquitin Carrier Protein C, Ubiquitin-protein Ligase C, dJ447F3.2) (AP)

Cat. Num. AAA24399

• Gene Names: UBE2C; UBCH10; dJ447F3.2
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: UBE2C, Antibody; UBE2C (Ubiquitin-conjugating Enzyme E2 C, UbcH10, Ubiquitin Carrier Protein C, Ubiquitin-protein Ligase C, dJ447F3.2) (AP); EC=6.3.2.19; anti-UBE2C antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 9D3
• Specificity: Recognizes human UBE2C.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-UBE2C antibody: ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa70-180 from human UBE2C (NP_008950) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: AGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Application Data

(Detection limit for recombinant GST tagged UBE2C is ~0.03ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to UBE2C on HeLa cell. [antibody concentration 10ug/ml].)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to UBE2C on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml].)

WB (Western Blot)

(Western Blot analysis of UBE2C expression in transfected 293T cell line by UBE2C monoclonal antibody. Lane 1: UBE2C transfected lysate (19.7kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(UBE2C monoclonal antibody, Western Blot analysis of UBE2C expression in HeLa.)

WB (Western Blot)

(Western Blot detection against Immunogen (38.21kD).)

Product Categories/Family for anti-UBE2C antibody

Antibodies; Ubiquitin

NCBI and Uniprot Product Information

• NCBI GI #: 5902146
• NCBI GeneID: 11065
• NCBI Accession #: NP_008950
• NCBI GenBank Nucleotide #: NM_007019
• UniProt Accession #: O00762; A6NP33; E1P5N7; G3XAB7
• Molecular Weight: 22.1 kDa (202aa), confirmed by MALDI-TOF
• NCBI Official Full Name: ubiquitin-conjugating enzyme E2 C isoform 1
• NCBI Official Synonym Full Names: ubiquitin conjugating enzyme E2 C
• NCBI Official Symbol: UBE2C
• NCBI Official Synonym Symbols: UBCH10; dJ447F3.2
• NCBI Protein Information: ubiquitin-conjugating enzyme E2 C
• UniProt Protein Name: Ubiquitin-conjugating enzyme E2 C
• UniProt Gene Name: UBE2C
• UniProt Synonym Gene Names: UBCH10
• UniProt Entry Name: UBE2C_HUMAN