Mouse anti-Human b2-Microglobulin Monoclonal Antibody | anti-B2M antibody

b2-Microglobulin (B2M, Beta-2-microglobulin) (APC)

Cat. Num. AAA24571

• Gene Names: B2M; IMD43
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: b2-Microglobulin, Antibody; b2-Microglobulin (B2M, Beta-2-microglobulin) (APC); anti-B2M antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 3F9-2C2
• Specificity: Recognizes human B2M.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-B2M antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-119 from human B2M (AAH32589) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(Western Blot analysis of B2M expression in transfected 293T cell line by B2M monoclonal antibody. Lane 1: B2M transfected lysate (13.7kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(B2M monoclonal antibody, Western Blot analysis of B2M expression in U-2 OS.)

Application Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between CALR and B2M. HeLa cells were stained with CALR rabbit purified polyclonal 1:1200 and B2M mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Application Data

(Detection limit for recombinant GST tagged B2M is ~0.03ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to B2M on HeLa cell. [antibody concentration 10ug/ml].)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to B2M on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 3ug/ml].)

WB (Western Blot)

(Western blot analysis of B2M over-expressed 293 cell line, cotransfected with B2M Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with B2M monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Product Categories/Family for anti-B2M antibody

Antibodies; Serum Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 21619743
• NCBI GeneID: 567
• Molecular Weight: 13,715 Da
• NCBI Official Full Name: Homo sapiens beta-2-microglobulin, mRNA
• NCBI Official Synonym Full Names: beta-2-microglobulin
• NCBI Official Symbol: B2M
• NCBI Official Synonym Symbols: IMD43
• NCBI Protein Information: beta-2-microglobulin