Loading...

Skip to main content
WB (Western Blot) (Western Blot analysis of B2M expression in transfected 293T cell line by B2M monoclonal antibody. Lane 1: B2M transfected lysate (13.7kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human b2-Microglobulin Monoclonal Antibody | anti-B2M antibody

b2-Microglobulin (B2M, Beta-2-microglobulin) (APC)

Gene Names
B2M; IMD43
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
b2-Microglobulin, Antibody; b2-Microglobulin (B2M, Beta-2-microglobulin) (APC); anti-B2M antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3F9-2C2
Specificity
Recognizes human B2M.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-B2M antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-119 from human B2M (AAH32589) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(Western Blot analysis of B2M expression in transfected 293T cell line by B2M monoclonal antibody. Lane 1: B2M transfected lysate (13.7kD). Lane 2: Non-transfected lysate.)

WB (Western Blot) (Western Blot analysis of B2M expression in transfected 293T cell line by B2M monoclonal antibody. Lane 1: B2M transfected lysate (13.7kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(B2M monoclonal antibody, Western Blot analysis of B2M expression in U-2 OS.)

WB (Western Blot) (B2M monoclonal antibody, Western Blot analysis of B2M expression in U-2 OS.)

Application Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between CALR and B2M. HeLa cells were stained with CALR rabbit purified polyclonal 1:1200 and B2M mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Application Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between CALR and B2M. HeLa cells were stained with CALR rabbit purified polyclonal 1:1200 and B2M mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Application Data

(Detection limit for recombinant GST tagged B2M is ~0.03ng/ml as a capture antibody.)

Application Data (Detection limit for recombinant GST tagged B2M is ~0.03ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to B2M on HeLa cell. [antibody concentration 10ug/ml].)

IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to B2M on HeLa cell. [antibody concentration 10ug/ml].)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to B2M on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 3ug/ml].)

IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to B2M on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 3ug/ml].)

WB (Western Blot)

(Western blot analysis of B2M over-expressed 293 cell line, cotransfected with B2M Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with B2M monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

WB (Western Blot) (Western blot analysis of B2M over-expressed 293 cell line, cotransfected with B2M Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with B2M monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)
Product Categories/Family for anti-B2M antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
567
Molecular Weight
13,715 Da
NCBI Official Full Name
Homo sapiens beta-2-microglobulin, mRNA
NCBI Official Synonym Full Names
beta-2-microglobulin
NCBI Official Symbol
B2M
NCBI Official Synonym Symbols
IMD43
NCBI Protein Information
beta-2-microglobulin

Similar Products

Product Notes

The B2M (Catalog #AAA24571) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The b2-Microglobulin (B2M, Beta-2-microglobulin) (APC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's b2-Microglobulin can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the B2M for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "b2-Microglobulin, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.