Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

WB (Western Blot) (Western blot analysis of ARID3A over-expressed 293 cell line, cotransfected with ARID3A Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ARID3A monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Mouse anti-Human ARID3A Monoclonal Antibody | anti-ARID3A antibody

ARID3A (AT-rich Interactive Domain-containing Protein 3A, ARID Domain-containing Protein 3A, B Cell Regulator of IgH Transcription, Bright, Dead Ringer-like Protein 1, E2F-binding Protein 1, DRIL1, DRIL3, DRX, E2FBP1) (Biotin)

Gene Names
ARID3A; DRIL1; DRIL3; BRIGHT; E2FBP1
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ARID3A; Monoclonal Antibody; ARID3A (AT-rich Interactive Domain-containing Protein 3A; ARID Domain-containing Protein 3A; B Cell Regulator of IgH Transcription; Bright; Dead Ringer-like Protein 1; E2F-binding Protein 1; DRIL1; DRIL3; DRX; E2FBP1) (Biotin); anti-ARID3A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1A11
Specificity
Recognizes human ARID3A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-ARID3A antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa317-416 from human ARID3A (NP_005215) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QYMKYLYPYECEKRGLSNPNELQAAIDSNRREGRRQSFGGSLFAYSPGGAHGMLSSPKLPVSSLGLAASTNGSSITPAPKIKKEEDSAIPITVPGRLPVS
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(Western blot analysis of ARID3A over-expressed 293 cell line, cotransfected with ARID3A Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ARID3A monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

WB (Western Blot) (Western blot analysis of ARID3A over-expressed 293 cell line, cotransfected with ARID3A Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ARID3A monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Application Data

(Detection limit for recombinant GST tagged ARID3A is ~0.03ng/ml as a capture antibody.)

Application Data (Detection limit for recombinant GST tagged ARID3A is ~0.03ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to ARID3A on HeLa cell. [antibody concentration 10ug/ml].)

IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to ARID3A on HeLa cell. [antibody concentration 10ug/ml].)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to ARID3A on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml].)

IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to ARID3A on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml].)

WB (Western Blot)

(ARID3A monoclonal antibody, Western Blot analysis of ARID3A expression in K-562.)

WB (Western Blot) (ARID3A monoclonal antibody, Western Blot analysis of ARID3A expression in K-562.)

WB (Western Blot)

(Western Blot detection against Immunogen (36.74kD).)

WB (Western Blot) (Western Blot detection against Immunogen (36.74kD).)
Product Categories/Family for anti-ARID3A antibody
References
1. Expression profiling of more than 3500 proteins of MSS-type colorectal cancer by stable isotope labeling and mass spectrometry. Kang UB, Yeom J, Kim HJ, Kim H, Lee C.J Proteomics. 2011 Nov 26.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62,889 Da
NCBI Official Full Name
AT-rich interactive domain-containing protein 3A
NCBI Official Synonym Full Names
AT rich interactive domain 3A (BRIGHT-like)
NCBI Official Symbol
ARID3A
NCBI Official Synonym Symbols
DRIL1; DRIL3; BRIGHT; E2FBP1
NCBI Protein Information
AT-rich interactive domain-containing protein 3A; ARID domain-containing 3A; ARID domain-containing protein 3A; AT rich interactive domain 3A (BRIGHT- like) protein; B-cell regulator of IgH transcription; E2F-binding protein 1; dead ringer-like 1; dead ri
UniProt Protein Name
AT-rich interactive domain-containing protein 3A
UniProt Gene Name
ARID3A
UniProt Synonym Gene Names
DRIL1; DRIL3; DRX; E2FBP1; ARID domain-containing protein 3A; Bright
UniProt Entry Name
ARI3A_HUMAN

Similar Products

Product Notes

The ARID3A arid3a (Catalog #AAA24729) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ARID3A (AT-rich Interactive Domain-containing Protein 3A, ARID Domain-containing Protein 3A, B Cell Regulator of IgH Transcription, Bright, Dead Ringer-like Protein 1, E2F-binding Protein 1, DRIL1, DRIL3, DRX, E2FBP1) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ARID3A can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ARID3A arid3a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ARID3A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.