Mouse anti-Human ANXA5 Monoclonal Antibody | anti-ANXA5 antibody

ANXA5 (Annexin A5, Annexin-5, Annexin V, Lipocortin V, Endonexin II, Calphobindin I, CBP-I, Placental Anticoagulant Protein I, PAP-I, Placental Anticoagulant Protein 4, PP4, Thromboplastin Inhibitor, Vascular Anticoagulant-alpha, VAC-alpha, Anchorin CII,

Cat. Num. AAA25321

• Gene Names: ANXA5; PP4; ANX5; ENX2; RPRGL3; HEL-S-7
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ANXA5, Antibody; ANXA5 (Annexin A5, Annexin-5, Annexin V, Lipocortin V, Endonexin II, Calphobindin I, CBP-I, Placental Anticoagulant Protein I, PAP-I, Placental Anticoagulant Protein 4, PP4, Thromboplastin Inhibitor, Vascular Anticoagulant-alpha, VAC-alpha, Anchorin CII,; anti-ANXA5 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1F4-1A5
• Specificity: Recognizes human ANXA5.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-ANXA5 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-320 from human ANXA5 (AAH01429) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(Western Blot detection against Immunogen (60.94kD).)

IP (Immunoprecipitation)

(Immunoprecipitation of ANXA5 transfected lysate using ANXA5 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with ANXA5 rabbit polyclonal antibody.)

Application Data

(Detection limit for recombinant GST tagged ANXA5 is ~0.03ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to ANXA5 on HeLa cell. [antibody concentration 10ug/ml].)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to ANXA5 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml].)

WB (Western Blot)

(Western Blot analysis of ANXA5 expression in transfected 293T cell line by ANXA5 monoclonal antibody. Lane 1: ANXA5 transfected lysate (35.9kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(ANXA5 monoclonal antibody, Western Blot analysis of ANXA5 expression in Hela.)

Product Categories/Family for anti-ANXA5 antibody

Antibodies; Apoptosis

References

1. Transcellular distribution heterogeneity of Annexin A5 represents a protective response to lupus-related thrombophilia: A pilot Proteomics-based study. Zhou D, Luo N, Wu Q, You Y, Zhai Z, Mou Z, Wu Y, Hao F.Biochem Biophys Res Commun. 2012 Apr 6;420(2):357-63. Epub 2012 Mar 8. 2. Proteomics and bioinformatics analysis of lovastatin-induced differentiation in ARO cells. Shui HA, Hsia CW, Chen HM, Chang TC, Wang CY.J Proteomics. 2011 Nov 7. 3. The Differential Expression of Aqueous Soluble Proteins in Breast Normal and Cancerous Tissues in Relation to Stage and Grade of Patients. Liang S, Singh M, Gam LH.Journal of Biomedicine and Biotechnology doi:10.1155/ 2010/516469

NCBI and Uniprot Product Information

• NCBI GI #: 33876205
• NCBI GeneID: 308
• Molecular Weight: 35,937 Da
• NCBI Official Full Name: Homo sapiens annexin A5, mRNA
• NCBI Official Synonym Full Names: annexin A5
• NCBI Official Symbol: ANXA5
• NCBI Official Synonym Symbols: PP4; ANX5; ENX2; RPRGL3; HEL-S-7
• NCBI Protein Information: annexin A5