Mouse EXOC4 Monoclonal Antibody | anti-EXOC4 antibody

EXOC4 (Exocyst Complex Component 4, Exocyst Complex Component Sec8, KIAA1699, SEC8, SEC8L1, MGC27170) (HRP)

Cat. Num. AAA25386

• Gene Names: EXOC4; SEC8; Sec8p; SEC8L1
• Reactivity: Human, Mouse, Rat
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: EXOC4, Antibody; EXOC4 (Exocyst Complex Component 4, Exocyst Complex Component Sec8, KIAA1699, SEC8, SEC8L1, MGC27170) (HRP); anti-EXOC4 antibody

• Host: Mouse
• Reactivity: Human, Mouse, Rat
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4F1
• Specificity: Recognizes human EXOC4. Species Crossreactivity: mouse and rat.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 974

• Applicable Applications for anti-EXOC4 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-110 from human EXOC4 (NP_068579) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MAAEAAGGKYRSTVSKSKDPSGLLISVIRTLSTSDDVEDRENEKGRLEEAYEKCDRDLDELIVQHYTELTTAIRTYQSITERITNSRNKIKQVKENLLSCKMLLHCKRD
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(EXOC4 monoclonal antibody. Western Blot analysis of EXOC4 expression in Raw 264.7.)

Application Data

(Detection limit for recombinant GST tagged EXOC4 is ~0.1ng/ml as a capture antibody.)

WB (Western Blot)

(EXOC4 monoclonal antibody. Western Blot analysis of EXOC4 expression in NIH/3T3.)

WB (Western Blot)

(EXOC4 monoclonal antibody, Western Blot analysis of EXOC4 expression in Hela NE.)

WB (Western Blot)

(EXOC4 monoclonal antibody. Western Blot analysis of EXOC4 expression in PC-12.)

WB (Western Blot)

(Western Blot detection against Immunogen (38.1kD).)

Related Product Information for anti-EXOC4 antibody

The protein encoded by this gene is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and functions of exocyst complex have been demonstrated to be highly conserved in higher eukaryotes. At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery. The complex is also essential for the biogenesis of epithelial cell surface polarity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq]

Product Categories/Family for anti-EXOC4 antibody

Antibodies; Neuroscience

NCBI and Uniprot Product Information

• NCBI GI #: 82546830
• NCBI GeneID: 60412
• NCBI Accession #: NP_068579
• NCBI GenBank Nucleotide #: NM_021807
• UniProt Accession #: Q96A65
• NCBI Official Full Name: exocyst complex component 4 isoform a
• NCBI Official Synonym Full Names: exocyst complex component 4
• NCBI Official Symbol: EXOC4
• NCBI Official Synonym Symbols: SEC8; Sec8p; SEC8L1
• NCBI Protein Information: exocyst complex component 4
• UniProt Protein Name: Exocyst complex component 4
• UniProt Gene Name: EXOC4
• UniProt Synonym Gene Names: KIAA1699; SEC8; SEC8L1
• UniProt Entry Name: EXOC4_HUMAN