Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

WB (Western Blot) (SLC25A13 monoclonal antibody Western Blot analysis of SLC25A13 expression in HepG2)

Mouse anti-Human SLC25A13 Monoclonal Antibody | anti-SLC25A13 antibody

SLC25A13 (Calcium-binding Mitochondrial Carrier Protein Aralar2, Mitochondrial Aspartate Glutamate Carrier 2, Solute Carrier Family 25 Member 13, Citrin, ARALAR2) (HRP)

Gene Names
SLC25A13; CTLN2; NICCD; CITRIN; ARALAR2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SLC25A13; Monoclonal Antibody; SLC25A13 (Calcium-binding Mitochondrial Carrier Protein Aralar2; Mitochondrial Aspartate Glutamate Carrier 2; Solute Carrier Family 25 Member 13; Citrin; ARALAR2) (HRP); anti-SLC25A13 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4F4
Specificity
Recognizes human SLC25A13.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
3141
Applicable Applications for anti-SLC25A13 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa2-80 from SLC25A13 (NP_055066) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AAAKVALTKRADPAELRTIFLKYASIEKNGEFFMSPNDFVTRYLNIFGESQPNPKTVELLSGVVDQTKDGLISFQEFVA
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(SLC25A13 monoclonal antibody Western Blot analysis of SLC25A13 expression in HepG2)

WB (Western Blot) (SLC25A13 monoclonal antibody Western Blot analysis of SLC25A13 expression in HepG2)

WB (Western Blot)

(Western blot analysis of SLC25A13 over-expressed 293 cell line, cotransfected with SLC25A13 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with SLC25A13 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

WB (Western Blot) (Western blot analysis of SLC25A13 over-expressed 293 cell line, cotransfected with SLC25A13 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with SLC25A13 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Application Data

(Detection limit for recombinant GST tagged SLC25A13 is ~0.3ng/ml as a capture antibody.)

Application Data (Detection limit for recombinant GST tagged SLC25A13 is ~0.3ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to SLC25A13 on HepG2 cell. [antibody concentration 10ug/ml])

IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to SLC25A13 on HepG2 cell. [antibody concentration 10ug/ml])

WB (Western Blot)

(Western Blot analysis of SLC25A13 expression in transfected 293T cell line by SLC25A13 monoclonal antibody Lane 1: SLC25A13 transfected lysate (74.2kD). Lane 2: Non-transfected lysate.)

WB (Western Blot) (Western Blot analysis of SLC25A13 expression in transfected 293T cell line by SLC25A13 monoclonal antibody Lane 1: SLC25A13 transfected lysate (74.2kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(Western Blot detection against Immunogen (34.8kD).)

WB (Western Blot) (Western Blot detection against Immunogen (34.8kD).)
Related Product Information for anti-SLC25A13 antibody
Catalyzes the calcium-dependent exchange of cytoplasmic glutamate with mitochondrial aspartate across the mitochondrial inner membrane. May have a function in the urea cycle.
Product Categories/Family for anti-SLC25A13 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens solute carrier family 25 member 13 (SLC25A13), transcript variant 2, mRNA
NCBI Official Synonym Full Names
solute carrier family 25 member 13
NCBI Official Symbol
SLC25A13
NCBI Official Synonym Symbols
CTLN2; NICCD; CITRIN; ARALAR2
NCBI Protein Information
calcium-binding mitochondrial carrier protein Aralar2
UniProt Protein Name
Calcium-binding mitochondrial carrier protein Aralar2
UniProt Gene Name
SLC25A13
UniProt Synonym Gene Names
ARALAR2
UniProt Entry Name
CMC2_HUMAN

Similar Products

Product Notes

The SLC25A13 slc25a13 (Catalog #AAA25542) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SLC25A13 (Calcium-binding Mitochondrial Carrier Protein Aralar2, Mitochondrial Aspartate Glutamate Carrier 2, Solute Carrier Family 25 Member 13, Citrin, ARALAR2) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC25A13 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SLC25A13 slc25a13 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC25A13, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.