<
WB (Western Blot)
(PKNOX2 monoclonal antibody. Western Blot analysis of PKNOX2 expression in NIH/3T3.)
Mouse anti-Human, Mouse PKNOX2 Monoclonal Antibody | anti-PKNOX2 antibody
PKNOX2 (PREP2, Homeobox Protein PKNOX2, Homeobox Protein PREP-2, PBX/Knotted Homeobox 2, FLJ13074) (PE)
Gene Names
PKNOX2; PREP2
Reactivity
Human, Mouse
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PKNOX2; Monoclonal Antibody; PKNOX2 (PREP2; Homeobox Protein PKNOX2; Homeobox Protein PREP-2; PBX/Knotted Homeobox 2; FLJ13074) (PE); anti-PKNOX2 antibody
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4B6
Specificity
Recognizes human PKNOX2. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-PKNOX2 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa116-216 from human PKNOX2 (NP_071345) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PELDNLMVKAIQVLRIHLLELEKVNELCKDFCNRYITCFKTKMHSDNLLRNDLGGPYSPNQPSINLHSQDLLQNSPNSMSGVSNNPQGIVVPASALQQGN
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
WB (Western Blot)
(PKNOX2 monoclonal antibody. Western Blot analysis of PKNOX2 expression in NIH/3T3.)
WB (Western Blot)
(PKNOX2 monoclonal antibody. Western Blot analysis of PKNOX2 expression in NIH/3T3.)
WB (Western Blot)
(Western blot analysis of PKNOX2 over-expressed 293 cell line, cotransfected with PKNOX2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PKNOX2 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)
WB (Western Blot)
(Western blot analysis of PKNOX2 over-expressed 293 cell line, cotransfected with PKNOX2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PKNOX2 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)
IF (Immunofluorescence)
(Immunofluorescence of monoclonal antibody to PKNOX2 on HeLa cell. [antibody concentration 10ug/ml].)
IF (Immunofluorescence)
(Immunofluorescence of monoclonal antibody to PKNOX2 on HeLa cell. [antibody concentration 10ug/ml].)
WB (Western Blot)
(Western Blot analysis of PKNOX2 expression in transfected 293T cell line by PKNOX2 monoclonal antibody. Lane 1: PKNOX2 transfected lysate (51.9kD). Lane 2: Non-transfected lysate.)
WB (Western Blot)
(Western Blot analysis of PKNOX2 expression in transfected 293T cell line by PKNOX2 monoclonal antibody. Lane 1: PKNOX2 transfected lysate (51.9kD). Lane 2: Non-transfected lysate.)
WB (Western Blot)
(PKNOX2 monoclonal antibody, Western Blot analysis of PKNOX2 expression in Hela NE.)
WB (Western Blot)
(PKNOX2 monoclonal antibody, Western Blot analysis of PKNOX2 expression in Hela NE.)
WB (Western Blot)
(Western Blot detection against Immunogen (37.11kD).)
WB (Western Blot)
(Western Blot detection against Immunogen (37.11kD).)
Product Categories/Family for anti-PKNOX2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
34kDa
NCBI Official Full Name
homeobox protein PKNOX2
NCBI Official Synonym Full Names
PBX/knotted 1 homeobox 2
NCBI Official Symbol
PKNOX2
NCBI Official Synonym Symbols
PREP2
NCBI Protein Information
homeobox protein PKNOX2
Similar Products
Product Notes
The PKNOX2 (Catalog #AAA25798) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PKNOX2 (PREP2, Homeobox Protein PKNOX2, Homeobox Protein PREP-2, PBX/Knotted Homeobox 2, FLJ13074) (PE) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's PKNOX2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PKNOX2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PKNOX2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
