Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to PRKDC on HeLa cell. [antibody concentration 40 ug/ml])

Mouse PRKDC Monoclonal Antibody | anti-PRKDC antibody

PRKDC (Protein Kinase, DNA-Activated, Catalytic Polypeptide, DNA-PKcs, DNAPK, DNPK1, HYRC, HYRC1, XRCC7, p350) (APC)

Gene Names
PRKDC; HYRC; p350; DNAPK; DNPK1; HYRC1; IMD26; XRCC7; DNAPKc; DNA-PKC; DNA-PKcs
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
PRKDC; Monoclonal Antibody; PRKDC (Protein Kinase; DNA-Activated; Catalytic Polypeptide; DNA-PKcs; DNAPK; DNPK1; HYRC; HYRC1; XRCC7; p350) (APC); Protein Kinase; p350; anti-PRKDC antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2A8
Specificity
Recognizes PRKDC.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
4128
Applicable Applications for anti-PRKDC antibody
Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PRKDC (NP_008835, 4019aa-4128aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KMLKKGGSWIQEINVAEKNWYPRQKICYAKRKLAGANPAVITCDELLLGHEKAPAFRDYVAVARGSKDHNIRAQEPESGLSEETQVKCLMDQATDPNILGRTWEGREPWM
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to PRKDC on HeLa cell. [antibody concentration 40 ug/ml])

IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to PRKDC on HeLa cell. [antibody concentration 40 ug/ml])

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to PRKDC on HeLa cell. [antibody concentration 40 ug/ml])

IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to PRKDC on HeLa cell. [antibody concentration 40 ug/ml])

Application Data

(Detection limit for recombinant GST tagged PRKDC is 1 ng/ml as a capture antibody.)

Application Data (Detection limit for recombinant GST tagged PRKDC is 1 ng/ml as a capture antibody.)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to PRKDC on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml])

IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to PRKDC on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml])

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to PRKDC on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml])

IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to PRKDC on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml])

WB (Western Blot)

(PRKDC monoclonal antibody (M03), clone 2A8 Western Blot analysis of PRKDC expression in Hela S3 NE.)

WB (Western Blot) (PRKDC monoclonal antibody (M03), clone 2A8 Western Blot analysis of PRKDC expression in Hela S3 NE.)
Related Product Information for anti-PRKDC antibody
The PRKDC gene encodes the catalytic subunit of a nuclear DNA-dependent serine/threonine protein kinase (DNA-PK). The second component is the autoimmune antigen Ku (MIM 152690), which is encoded by the G22P1 gene on chromosome 22q. On its own, the catalytic subunit of DNA-PK is inactive and relies on the G22P1 component to direct it to the DNA and trigger its kinase activity; PRKDC must be bound to DNA to express its catalytic properties. [supplied by OMIM]
Product Categories/Family for anti-PRKDC antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
DNA-dependent protein kinase catalytic subunit isoform 1
NCBI Official Synonym Full Names
protein kinase, DNA-activated, catalytic subunit
NCBI Official Symbol
PRKDC
NCBI Official Synonym Symbols
HYRC; p350; DNAPK; DNPK1; HYRC1; IMD26; XRCC7; DNAPKc; DNA-PKC; DNA-PKcs
NCBI Protein Information
DNA-dependent protein kinase catalytic subunit
UniProt Protein Name
DNA-dependent protein kinase catalytic subunit
UniProt Gene Name
PRKDC
UniProt Synonym Gene Names
HYRC; HYRC1; DNA-PK catalytic subunit; DNA-PKcs
UniProt Entry Name
PRKDC_HUMAN

Similar Products

Product Notes

The PRKDC prkdc (Catalog #AAA26089) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PRKDC can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PRKDC prkdc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PRKDC, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.